Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 4278051..4278594 | Replicon | chromosome |
| Accession | NZ_LT907988 | ||
| Organism | Orrella dioscoreae isolate Orrdi1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | ODI_RS19635 | Protein ID | WP_067754198.1 |
| Coordinates | 4278051..4278332 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | ODI_RS19640 | Protein ID | WP_067754195.1 |
| Coordinates | 4278391..4278594 (-) | Length | 68 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ODI_RS19610 | 4273867..4274145 | + | 279 | WP_067754214.1 | hypothetical protein | - |
| ODI_RS19615 | 4274106..4274720 | + | 615 | WP_067754211.1 | 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD | - |
| ODI_RS19620 | 4274770..4275390 | + | 621 | WP_067754206.1 | glutathione S-transferase | - |
| ODI_RS19625 | 4275642..4276205 | + | 564 | WP_067754205.1 | peroxiredoxin | - |
| ODI_RS19630 | 4276363..4277955 | + | 1593 | WP_067754203.1 | alkyl hydroperoxide reductase subunit F | - |
| ODI_RS19635 | 4278051..4278332 | - | 282 | WP_067754198.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
| ODI_RS19640 | 4278391..4278594 | - | 204 | WP_067754195.1 | hypothetical protein | Antitoxin |
| ODI_RS19645 | 4278739..4280655 | - | 1917 | WP_067754192.1 | molecular chaperone HtpG | - |
| ODI_RS19655 | 4281049..4282152 | + | 1104 | WP_067754189.1 | site-specific integrase | - |
| ODI_RS19660 | 4282319..4283374 | - | 1056 | WP_067754187.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10515.32 Da Isoelectric Point: 11.2805
>T293819 WP_067754198.1 NZ_LT907988:c4278332-4278051 [Orrella dioscoreae]
MLPVQWRASARADLMAILAFITEDSPGAARKMKRLVSEATLSAARHPEWFRPGRVAGTRELVISANYILVYRVMVTHLEV
VSVLHARREYPRG
MLPVQWRASARADLMAILAFITEDSPGAARKMKRLVSEATLSAARHPEWFRPGRVAGTRELVISANYILVYRVMVTHLEV
VSVLHARREYPRG
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|