Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 3729232..3729887 Replicon chromosome
Accession NZ_LT907988
Organism Orrella dioscoreae isolate Orrdi1

Toxin (Protein)


Gene name vapC Uniprot ID A0A1C3JY99
Locus tag ODI_RS17275 Protein ID WP_067750010.1
Coordinates 3729462..3729887 (+) Length 142 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag ODI_RS17270 Protein ID WP_067750012.1
Coordinates 3729232..3729462 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ODI_RS17240 3724806..3725717 + 912 WP_082985153.1 alpha/beta fold hydrolase -
ODI_RS17245 3725714..3726406 - 693 WP_098020932.1 esterase -
ODI_RS17250 3726516..3727205 - 690 WP_067750022.1 LrgB family protein -
ODI_RS17255 3727195..3727602 - 408 WP_067750016.1 CidA/LrgA family protein -
ODI_RS17260 3727716..3728603 + 888 WP_067750014.1 LysR family transcriptional regulator -
ODI_RS17265 3728588..3729031 - 444 WP_067750013.1 multidrug/biocide efflux PACE transporter -
ODI_RS17270 3729232..3729462 + 231 WP_067750012.1 antitoxin Antitoxin
ODI_RS17275 3729462..3729887 + 426 WP_067750010.1 tRNA(fMet)-specific endonuclease VapC Toxin
ODI_RS17280 3729902..3730768 + 867 WP_067750008.1 LysR family transcriptional regulator -
ODI_RS17285 3730860..3731357 + 498 WP_067750006.1 helix-turn-helix domain-containing protein -
ODI_RS17290 3731354..3732013 + 660 WP_067750001.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
ODI_RS17295 3732021..3732866 - 846 WP_067749998.1 pyridoxal kinase -
ODI_RS17300 3732945..3734114 - 1170 WP_197707106.1 PQQ-dependent sugar dehydrogenase -
ODI_RS17305 3734111..3734614 - 504 WP_067749996.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-124)

Antitoxin

SpoVT-AbrB domain

(7-55)


Sequences

Toxin        


Download         Length: 142 a.a.        Molecular weight: 15551.72 Da        Isoelectric Point: 7.8532

>T293818 WP_067750010.1 NZ_LT907988:3729462-3729887 [Orrella dioscoreae]
MQKWMLDTNICIYTIKNRPERVRHAFNQRSSSLCISTISAMELVYGAEKSASPARNLATVEGFLARLDVLDYDRAAAINT
GQLRAELAQAGTPIGAYDAMIAGHARSRGFVLVSNNTREFTRVPGLRLEDWALGPEDTPPL

Download         Length: 426 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8445.43 Da        Isoelectric Point: 5.0022

>AT293818 WP_067750012.1 NZ_LT907988:3729232-3729462 [Orrella dioscoreae]
MEQGAIFKSNRSQAVRLPKAAAMPEGVTRVDILSIGRTRILAPAGEAWDSWFQAEGASADFMDTRDQPADQHRETW

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1C3JY99

Antitoxin

Source ID Structure

References