Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3476711..3477405 | Replicon | chromosome |
| Accession | NZ_LT907988 | ||
| Organism | Orrella dioscoreae isolate Orrdi1 | ||
Toxin (Protein)
| Gene name | VapC1 | Uniprot ID | - |
| Locus tag | ODI_RS16190 | Protein ID | WP_067752093.1 |
| Coordinates | 3476998..3477405 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | VapB1 | Uniprot ID | A0A1C3K0R5 |
| Locus tag | ODI_RS16185 | Protein ID | WP_067752091.1 |
| Coordinates | 3476711..3476998 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ODI_RS16175 | 3472131..3475379 | - | 3249 | WP_067752085.1 | carbamoyl-phosphate synthase large subunit | - |
| ODI_RS16180 | 3475389..3476543 | - | 1155 | WP_067752088.1 | glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit | - |
| ODI_RS16185 | 3476711..3476998 | + | 288 | WP_067752091.1 | hypothetical protein | Antitoxin |
| ODI_RS16190 | 3476998..3477405 | + | 408 | WP_067752093.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| ODI_RS16195 | 3477504..3478463 | + | 960 | WP_067752096.1 | transaldolase | - |
| ODI_RS16200 | 3478783..3480480 | + | 1698 | WP_067752099.1 | L-lactate permease | - |
| ODI_RS16205 | 3480540..3481769 | - | 1230 | WP_067752102.1 | YeeE/YedE family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15257.73 Da Isoelectric Point: 9.1310
>T293816 WP_067752093.1 NZ_LT907988:3476998-3477405 [Orrella dioscoreae]
MRYLLDTNILIYLIKHRPPSVAERIAQLALDDALHMSFVSWAELLKGAERSTRADTVRKQLHKLAQHIPVLYETSHDMCL
HHARLGAMFKSQGKPIGANDLWIAAHALAEGCVLVTNNTREFSRVPGLPLQNWVQ
MRYLLDTNILIYLIKHRPPSVAERIAQLALDDALHMSFVSWAELLKGAERSTRADTVRKQLHKLAQHIPVLYETSHDMCL
HHARLGAMFKSQGKPIGANDLWIAAHALAEGCVLVTNNTREFSRVPGLPLQNWVQ
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|