Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-PumB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 913507..914105 | Replicon | chromosome |
| Accession | NZ_LT907988 | ||
| Organism | Orrella dioscoreae isolate Orrdi1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | ODI_RS04120 | Protein ID | WP_067752359.1 |
| Coordinates | 913806..914105 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | ODI_RS04115 | Protein ID | WP_067752229.1 |
| Coordinates | 913507..913803 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ODI_RS04095 | 908511..909851 | + | 1341 | WP_067752239.1 | DUF3100 domain-containing protein | - |
| ODI_RS04100 | 909863..910756 | + | 894 | WP_067752237.1 | NAD(P)-dependent oxidoreductase | - |
| ODI_RS04105 | 910753..912270 | + | 1518 | WP_067752234.1 | aldehyde dehydrogenase family protein | - |
| ODI_RS04110 | 912307..913479 | + | 1173 | WP_067752232.1 | amidohydrolase | - |
| ODI_RS04115 | 913507..913803 | - | 297 | WP_067752229.1 | putative addiction module antidote protein | Antitoxin |
| ODI_RS04120 | 913806..914105 | - | 300 | WP_067752359.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ODI_RS04125 | 914293..915681 | - | 1389 | WP_067752226.1 | L-serine ammonia-lyase | - |
| ODI_RS04130 | 915797..916729 | + | 933 | WP_067752223.1 | LysR family transcriptional regulator | - |
| ODI_RS04135 | 916755..918359 | - | 1605 | WP_082985254.1 | NAD(P)H-hydrate dehydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11293.04 Da Isoelectric Point: 11.2365
>T293814 WP_067752359.1 NZ_LT907988:c914105-913806 [Orrella dioscoreae]
MIRVYTTPTFDRWFAQIDDTLTAKRIQVRIRRLQLGNHGDWAPIGEGVAELRIHHGPGYRVVFMPRTTDIIVLLAGGDKS
TQPRDIRAALSLARQLRET
MIRVYTTPTFDRWFAQIDDTLTAKRIQVRIRRLQLGNHGDWAPIGEGVAELRIHHGPGYRVVFMPRTTDIIVLLAGGDKS
TQPRDIRAALSLARQLRET
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|