Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB-HicA |
| Location | 2190258..2190881 | Replicon | chromosome |
| Accession | NZ_LT907978 | ||
| Organism | Anaerobutyricum hallii isolate EH1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | EHLA_RS10010 | Protein ID | WP_096240713.1 |
| Coordinates | 2190258..2190446 (+) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | EHLA_RS10015 | Protein ID | WP_096240714.1 |
| Coordinates | 2190492..2190881 (+) | Length | 130 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EHLA_RS16425 | 2185960..2186127 | - | 168 | WP_173854288.1 | hypothetical protein | - |
| EHLA_RS10000 | 2186433..2187890 | + | 1458 | WP_096239442.1 | transposase | - |
| EHLA_RS10005 | 2188457..2189689 | - | 1233 | WP_096240712.1 | hypothetical protein | - |
| EHLA_RS16260 | 2189875..2190033 | - | 159 | WP_157908579.1 | hypothetical protein | - |
| EHLA_RS10010 | 2190258..2190446 | + | 189 | WP_096240713.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| EHLA_RS10015 | 2190492..2190881 | + | 390 | WP_096240714.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| EHLA_RS10020 | 2191137..2192549 | - | 1413 | WP_096240715.1 | oxaloacetate decarboxylase subunit alpha | - |
| EHLA_RS10025 | 2192622..2193746 | - | 1125 | WP_005349917.1 | sodium ion-translocating decarboxylase subunit beta | - |
| EHLA_RS10030 | 2193780..2194148 | - | 369 | WP_096240716.1 | biotin/lipoyl-binding protein | - |
| EHLA_RS10035 | 2194253..2194600 | - | 348 | WP_096240717.1 | OadG family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2154116..2190881 | 36765 | |
| - | flank | IS/Tn | - | - | 2186433..2187890 | 1457 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7003.45 Da Isoelectric Point: 11.1455
>T293811 WP_096240713.1 NZ_LT907978:2190258-2190446 [Anaerobutyricum hallii]
MPMKPQEMIRLLKKNGFIKISQNGSHVKMKNFKTGKQTTVPLHSKDLKKGLEDAILKQAGLK
MPMKPQEMIRLLKKNGFIKISQNGSHVKMKNFKTGKQTTVPLHSKDLKKGLEDAILKQAGLK
Download Length: 189 bp
Antitoxin
Download Length: 130 a.a. Molecular weight: 15005.08 Da Isoelectric Point: 4.4926
>AT293811 WP_096240714.1 NZ_LT907978:2190492-2190881 [Anaerobutyricum hallii]
MKKLFYPAVFHIAEEGGYWVTFPDFPECLTQGENMQEAYDMAIDALGLILTDDINDRKELPEPSNITHVDDGVVVIIPYD
YLEYNRKYHNKSIKKTLTIPEWLNNEALRLNLNFSQILQDALLNKIQSR
MKKLFYPAVFHIAEEGGYWVTFPDFPECLTQGENMQEAYDMAIDALGLILTDDINDRKELPEPSNITHVDDGVVVIIPYD
YLEYNRKYHNKSIKKTLTIPEWLNNEALRLNLNFSQILQDALLNKIQSR
Download Length: 390 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|