Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 301450..302098 | Replicon | chromosome |
Accession | NZ_LT906480 | ||
Organism | Stenotrophomonas maltophilia strain NCTC10257 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | CKW06_RS01455 | Protein ID | WP_005407702.1 |
Coordinates | 301450..301755 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | CKW06_RS01460 | Protein ID | WP_005407703.1 |
Coordinates | 301796..302098 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKW06_RS01425 | 297404..298195 | - | 792 | WP_169922258.1 | zinc-dependent peptidase | - |
CKW06_RS01430 | 298162..298440 | - | 279 | WP_005411956.1 | hypothetical protein | - |
CKW06_RS01435 | 298585..299550 | + | 966 | WP_024956165.1 | bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor | - |
CKW06_RS01440 | 299547..300278 | + | 732 | WP_005407698.1 | type III pantothenate kinase | - |
CKW06_RS01445 | 300288..301142 | + | 855 | WP_005411958.1 | SPOR domain-containing protein | - |
CKW06_RS01455 | 301450..301755 | + | 306 | WP_005407702.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CKW06_RS01460 | 301796..302098 | + | 303 | WP_005407703.1 | putative addiction module antidote protein | Antitoxin |
CKW06_RS01465 | 302356..302655 | - | 300 | WP_143568664.1 | hypothetical protein | - |
CKW06_RS01470 | 302736..303143 | - | 408 | WP_024956163.1 | hypothetical protein | - |
CKW06_RS01475 | 303738..304508 | + | 771 | WP_005411960.1 | DUF3011 domain-containing protein | - |
CKW06_RS01480 | 304533..304880 | - | 348 | WP_024956162.1 | hypothetical protein | - |
CKW06_RS01485 | 305011..305931 | + | 921 | WP_005407709.1 | arginase | - |
CKW06_RS01490 | 306092..306229 | + | 138 | WP_005407710.1 | entericidin A/B family lipoprotein | - |
CKW06_RS01495 | 306437..306658 | + | 222 | WP_004153772.1 | CsbD family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 260123..304880 | 44757 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11444.15 Da Isoelectric Point: 10.9897
>T293783 WP_005407702.1 NZ_LT906480:301450-301755 [Stenotrophomonas maltophilia]
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLADGVSELRIDAGPGYRVYYTQRGRQLVILLVGGDKGS
QQRDIEKAKEIARALRASNWL
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLADGVSELRIDAGPGYRVYYTQRGRQLVILLVGGDKGS
QQRDIEKAKEIARALRASNWL
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|