Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 4880938..4881677 | Replicon | chromosome |
Accession | NZ_LT906479 | ||
Organism | Serratia ficaria strain NCTC12148 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | CKW09_RS22910 | Protein ID | WP_095099675.1 |
Coordinates | 4881198..4881677 (+) | Length | 160 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A240CCP7 |
Locus tag | CKW09_RS22905 | Protein ID | WP_061798971.1 |
Coordinates | 4880938..4881201 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKW09_RS22885 | 4877018..4877698 | + | 681 | WP_095099668.1 | GMP/IMP nucleotidase | - |
CKW09_RS22890 | 4877695..4878102 | + | 408 | WP_061798964.1 | ribosome-associated heat shock protein Hsp15 | - |
CKW09_RS22895 | 4878128..4879006 | + | 879 | WP_061798966.1 | Hsp33 family molecular chaperone HslO | - |
CKW09_RS22900 | 4879193..4880812 | + | 1620 | WP_095099672.1 | phosphoenolpyruvate carboxykinase (ATP) | - |
CKW09_RS22905 | 4880938..4881201 | + | 264 | WP_061798971.1 | hypothetical protein | Antitoxin |
CKW09_RS22910 | 4881198..4881677 | + | 480 | WP_095099675.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
CKW09_RS22915 | 4881700..4883070 | - | 1371 | WP_061798975.1 | two-component system sensor histidine kinase EnvZ | - |
CKW09_RS22920 | 4883067..4883786 | - | 720 | WP_004709363.1 | two-component system response regulator OmpR | - |
CKW09_RS22925 | 4884097..4884411 | - | 315 | WP_061798977.1 | chaperone-modulator protein CbpM | - |
CKW09_RS22930 | 4884414..4885364 | - | 951 | WP_095099678.1 | curved DNA-binding protein | - |
CKW09_RS22935 | 4885595..4886068 | + | 474 | WP_061798982.1 | transcription elongation factor GreB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 160 a.a. Molecular weight: 17854.53 Da Isoelectric Point: 6.4742
>T293781 WP_095099675.1 NZ_LT906479:4881198-4881677 [Serratia ficaria]
MIILDTNVMSETLRPSPHYNVINWLNEKDNDELYLSAIVIAELFNGAACMPDGKRQRDLKLKLADAIQLKFEGQTLPFDG
LCAMQYAELTARNRLQGKLMSVPDAQIAATCLHYGAALATRNSKNFLHCGIELIDPWQAPAGRRLHEDAAEYYVMSRKS
MIILDTNVMSETLRPSPHYNVINWLNEKDNDELYLSAIVIAELFNGAACMPDGKRQRDLKLKLADAIQLKFEGQTLPFDG
LCAMQYAELTARNRLQGKLMSVPDAQIAATCLHYGAALATRNSKNFLHCGIELIDPWQAPAGRRLHEDAAEYYVMSRKS
Download Length: 480 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|