Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH |
Location | 4259367..4260090 | Replicon | chromosome |
Accession | NZ_LT906479 | ||
Organism | Serratia ficaria strain NCTC12148 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | CKW09_RS20060 | Protein ID | WP_095099094.1 |
Coordinates | 4259367..4259753 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | CKW09_RS20065 | Protein ID | WP_046899002.1 |
Coordinates | 4259746..4260090 (+) | Length | 115 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKW09_RS20040 | 4254961..4256223 | + | 1263 | WP_095099091.1 | cysteine desulfurase-like protein | - |
CKW09_RS20050 | 4256476..4257993 | - | 1518 | WP_061796927.1 | lysine--tRNA ligase | - |
CKW09_RS20060 | 4259367..4259753 | + | 387 | WP_095099094.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CKW09_RS20065 | 4259746..4260090 | + | 345 | WP_046899002.1 | helix-turn-helix domain-containing protein | Antitoxin |
CKW09_RS20070 | 4260142..4261875 | - | 1734 | WP_095099097.1 | single-stranded-DNA-specific exonuclease RecJ | - |
CKW09_RS20075 | 4261882..4262598 | - | 717 | WP_061796933.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
CKW09_RS20080 | 4262627..4263526 | - | 900 | WP_095100284.1 | site-specific tyrosine recombinase XerD | - |
CKW09_RS20085 | 4263633..4264151 | + | 519 | WP_061796935.1 | flavodoxin FldB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14621.64 Da Isoelectric Point: 8.4849
>T293778 WP_095099094.1 NZ_LT906479:4259367-4259753 [Serratia ficaria]
MDIFVTDDFDKFMKKNRIVDQKICTAAHELEHGNHDGDLGGGVYKKRLPLNRGKRGGARSIVAFKHGRHQYFVDGWLKNT
VKQNGAKEINDDELATYRELAKDFLAMPPEIIKRAIDSGYLREVKCDD
MDIFVTDDFDKFMKKNRIVDQKICTAAHELEHGNHDGDLGGGVYKKRLPLNRGKRGGARSIVAFKHGRHQYFVDGWLKNT
VKQNGAKEINDDELATYRELAKDFLAMPPEIIKRAIDSGYLREVKCDD
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|