Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3810645..3811207 Replicon chromosome
Accession NZ_LT906479
Organism Serratia ficaria strain NCTC12148

Toxin (Protein)


Gene name doc Uniprot ID A0A240C794
Locus tag CKW09_RS18000 Protein ID WP_061799378.1
Coordinates 3810645..3811001 (-) Length 119 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A240C7D1
Locus tag CKW09_RS18005 Protein ID WP_061799380.1
Coordinates 3810998..3811207 (-) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CKW09_RS17975 3805875..3806795 + 921 WP_095098630.1 oxygen-dependent coproporphyrinogen oxidase -
CKW09_RS17980 3806795..3807250 + 456 WP_061799412.1 YaiI/YqxD family protein -
CKW09_RS17985 3807269..3808108 - 840 WP_095098633.1 ChaN family lipoprotein -
CKW09_RS17990 3808302..3809711 + 1410 WP_095098639.1 S-methylmethionine permease -
CKW09_RS17995 3809701..3810639 + 939 WP_061799377.1 homocysteine S-methyltransferase -
CKW09_RS18000 3810645..3811001 - 357 WP_061799378.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
CKW09_RS18005 3810998..3811207 - 210 WP_061799380.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
CKW09_RS18010 3811305..3813584 - 2280 WP_095098647.1 NADP-dependent oxaloacetate-decarboxylating malate dehydrogenase -
CKW09_RS24755 3813770..3813943 - 174 WP_165283073.1 hypothetical protein -
CKW09_RS18015 3813924..3814304 - 381 WP_061799384.1 DUF2570 family protein -
CKW09_RS18020 3814301..3814702 - 402 WP_061799389.1 M15 family metallopeptidase -
CKW09_RS18025 3814692..3815018 - 327 WP_061799391.1 phage holin, lambda family -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(20-108)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-52)


Sequences

Toxin        


Download         Length: 119 a.a.        Molecular weight: 13032.87 Da        Isoelectric Point: 5.1312

>T293776 WP_061799378.1 NZ_LT906479:c3811001-3810645 [Serratia ficaria]
MIFLTAEDIAEFNAEIVPQGRQDGSKVEAVANRVLNAYHYDNVSDIYHLAAIYLIAISQGHIFLDGNKRTAFQSMALFLG
INGIALREDAKLVELTVEAAKGRLNAVETAKQLRQLTE

Download         Length: 357 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 7829.87 Da        Isoelectric Point: 8.5262

>AT293776 WP_061799380.1 NZ_LT906479:c3811207-3810998 [Serratia ficaria]
MTTISYTSARNNLAEVFQEAQNQPVEVTRRGHDEVYIISKADYEVLVKAKVKARIQLKHADTINALADR

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A240C794

Antitoxin

Source ID Structure
AlphaFold DB A0A240C7D1

References