Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3160479..3161110 | Replicon | chromosome |
Accession | NZ_LT906479 | ||
Organism | Serratia ficaria strain NCTC12148 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | CKW09_RS14990 | Protein ID | WP_019452963.1 |
Coordinates | 3160479..3160877 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A240C5I5 |
Locus tag | CKW09_RS14995 | Protein ID | WP_061794711.1 |
Coordinates | 3160877..3161110 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKW09_RS14965 | 3156048..3156422 | + | 375 | WP_095098030.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
CKW09_RS14970 | 3156415..3156717 | + | 303 | WP_061794706.1 | DNA-binding transcriptional regulator | - |
CKW09_RS14975 | 3156727..3157131 | - | 405 | WP_061794707.1 | flagellar protein FlhE | - |
CKW09_RS14980 | 3157131..3159209 | - | 2079 | WP_095098033.1 | flagellar biosynthesis protein FlhA | - |
CKW09_RS14985 | 3159202..3160353 | - | 1152 | WP_095098036.1 | flagellar type III secretion system protein FlhB | - |
CKW09_RS14990 | 3160479..3160877 | - | 399 | WP_019452963.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
CKW09_RS14995 | 3160877..3161110 | - | 234 | WP_061794711.1 | antitoxin | Antitoxin |
CKW09_RS15000 | 3161237..3161881 | - | 645 | WP_061794712.1 | protein phosphatase CheZ | - |
CKW09_RS15005 | 3161892..3162281 | - | 390 | WP_006326141.1 | chemotaxis response regulator CheY | - |
CKW09_RS15010 | 3162385..3163434 | - | 1050 | WP_061794713.1 | chemotaxis response regulator protein-glutamate methylesterase | - |
CKW09_RS15015 | 3163434..3164306 | - | 873 | WP_095098039.1 | protein-glutamate O-methyltransferase CheR | - |
CKW09_RS15020 | 3164335..3165960 | - | 1626 | WP_061794715.1 | Tar ligand binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14876.02 Da Isoelectric Point: 8.4955
>T293775 WP_019452963.1 NZ_LT906479:c3160877-3160479 [Serratia ficaria]
MFSHMLDTNIVIYVIKRRPLEVLEAFNRYAGKMVISSVTYGELVHGVEKSSRPAVNARVVEDFVSRLDILDYGAKAASHY
GNIRAALERQGTPIGVNDLHIAGHARSEGLILVTNNRREFERVDGLRLENWL
MFSHMLDTNIVIYVIKRRPLEVLEAFNRYAGKMVISSVTYGELVHGVEKSSRPAVNARVVEDFVSRLDILDYGAKAASHY
GNIRAALERQGTPIGVNDLHIAGHARSEGLILVTNNRREFERVDGLRLENWL
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|