Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1218511..1219134 Replicon chromosome
Accession NZ_LT906479
Organism Serratia ficaria strain NCTC12148

Toxin (Protein)


Gene name Hha Uniprot ID A0A240BII5
Locus tag CKW09_RS05705 Protein ID WP_061796337.1
Coordinates 1218511..1218714 (-) Length 68 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A2X2G5J9
Locus tag CKW09_RS05710 Protein ID WP_004940312.1
Coordinates 1218766..1219134 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CKW09_RS05680 1213526..1213840 - 315 WP_061796310.1 MGMT family protein -
CKW09_RS05690 1214197..1215540 - 1344 WP_095096053.1 NCS2 family permease -
CKW09_RS05695 1215572..1217365 - 1794 WP_095096056.1 adenine deaminase -
CKW09_RS05700 1217502..1218431 + 930 WP_061796335.1 LysR family transcriptional regulator -
CKW09_RS05705 1218511..1218714 - 204 WP_061796337.1 hemolysin expression modulator Hha Toxin
CKW09_RS05710 1218766..1219134 - 369 WP_004940312.1 Hha toxicity modulator TomB Antitoxin
CKW09_RS05715 1219294..1219647 - 354 WP_095096059.1 hypothetical protein -
CKW09_RS24670 1219931..1220077 + 147 WP_167387233.1 hypothetical protein -
CKW09_RS05720 1220074..1220787 + 714 WP_095096062.1 ABC transporter ATP-binding protein -
CKW09_RS05725 1220784..1221641 + 858 WP_061796344.1 metal ABC transporter permease -
CKW09_RS05730 1221667..1222545 + 879 WP_061796346.1 metal ABC transporter substrate-binding protein -
CKW09_RS05735 1222654..1222794 - 141 WP_073970263.1 type B 50S ribosomal protein L36 -
CKW09_RS05740 1222804..1223064 - 261 WP_095096066.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1223222..1224019 797


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(8-64)

Antitoxin

Biofilm formation regulator YbaJ

(1-118)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 8103.42 Da        Isoelectric Point: 6.9756

>T293770 WP_061796337.1 NZ_LT906479:c1218714-1218511 [Serratia ficaria]
MTKIDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTAVWKYVR

Download         Length: 204 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 14261.95 Da        Isoelectric Point: 4.4314

>AT293770 WP_004940312.1 NZ_LT906479:c1219134-1218766 [Serratia ficaria]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A240BII5

Antitoxin

Source ID Structure
AlphaFold DB A0A2X2G5J9

References