Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemK-mazE/MazF(toxin) |
| Location | 881862..882491 | Replicon | chromosome |
| Accession | NZ_LT906478 | ||
| Organism | Listeria ivanovii subsp. ivanovii strain NCTC11846 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A097BBV7 |
| Locus tag | CKV67_RS04250 | Protein ID | WP_025279828.1 |
| Coordinates | 882144..882491 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G2ZDP2 |
| Locus tag | CKV67_RS04245 | Protein ID | WP_014092317.1 |
| Coordinates | 881862..882140 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CKV67_RS04225 | 877202..878674 | + | 1473 | WP_014092313.1 | PH domain-containing protein | - |
| CKV67_RS04230 | 878795..880174 | + | 1380 | WP_014092314.1 | protoporphyrinogen oxidase | - |
| CKV67_RS04235 | 880176..880532 | + | 357 | WP_014092315.1 | holo-ACP synthase | - |
| CKV67_RS04240 | 880550..881656 | + | 1107 | WP_014092316.1 | alanine racemase | - |
| CKV67_RS04245 | 881862..882140 | + | 279 | WP_014092317.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| CKV67_RS04250 | 882144..882491 | + | 348 | WP_025279828.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| CKV67_RS04255 | 882741..883577 | + | 837 | WP_014092318.1 | STAS domain-containing protein | - |
| CKV67_RS04260 | 883583..883939 | + | 357 | WP_003721457.1 | STAS domain-containing protein | - |
| CKV67_RS04265 | 883942..884352 | + | 411 | WP_014092320.1 | anti-sigma regulatory factor | - |
| CKV67_RS04270 | 884369..885373 | + | 1005 | WP_025279829.1 | PP2C family protein-serine/threonine phosphatase | - |
| CKV67_RS04275 | 885525..885869 | + | 345 | WP_014092322.1 | anti sigma b factor antagonist RsbV | - |
| CKV67_RS04280 | 885853..886326 | + | 474 | WP_014092323.1 | anti-sigma B factor RsbW | - |
| CKV67_RS04285 | 886304..887083 | + | 780 | WP_014092324.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12829.90 Da Isoelectric Point: 6.4735
>T293767 WP_025279828.1 NZ_LT906478:882144-882491 [Listeria ivanovii subsp. ivanovii]
MMVKRGDVYYADLSPVVGSEQGGIRPVLIIQNDIGNRFSPTVIVAAITAKIQKAKLPTHVEATRKDGFERDSVILLEQIR
TIDKQRLTDKITHLDEELMVKVNQALEVSLGVVEF
MMVKRGDVYYADLSPVVGSEQGGIRPVLIIQNDIGNRFSPTVIVAAITAKIQKAKLPTHVEATRKDGFERDSVILLEQIR
TIDKQRLTDKITHLDEELMVKVNQALEVSLGVVEF
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A097BBV7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G2ZDP2 |