Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 3325129..3325666 | Replicon | chromosome |
Accession | NZ_LT906476 | ||
Organism | Legionella pneumophila strain NCTC11286 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | CKV96_RS15105 | Protein ID | WP_027266055.1 |
Coordinates | 3325129..3325425 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | CKV96_RS15110 | Protein ID | WP_027266056.1 |
Coordinates | 3325415..3325666 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKV96_RS15080 | 3321221..3322117 | - | 897 | WP_027266053.1 | hypothetical protein | - |
CKV96_RS15085 | 3322385..3322576 | + | 192 | WP_014327021.1 | hypothetical protein | - |
CKV96_RS15090 | 3323047..3323586 | - | 540 | WP_062730332.1 | sel1 repeat family protein | - |
CKV96_RS15095 | 3323546..3324199 | - | 654 | WP_027266054.1 | hypothetical protein | - |
CKV96_RS15100 | 3324558..3325040 | - | 483 | WP_014842908.1 | hypothetical protein | - |
CKV96_RS15105 | 3325129..3325425 | - | 297 | WP_027266055.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CKV96_RS15110 | 3325415..3325666 | - | 252 | WP_027266056.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
CKV96_RS15115 | 3325830..3327035 | + | 1206 | WP_061638482.1 | ISNCY family transposase | - |
CKV96_RS15120 | 3327208..3327947 | - | 740 | Protein_2890 | site-specific integrase | - |
CKV96_RS15125 | 3327986..3329125 | - | 1140 | WP_134984249.1 | DUF3800 domain-containing protein | - |
CKV96_RS15835 | 3329243..3329608 | - | 366 | WP_197697735.1 | recombinase family protein | - |
CKV96_RS15840 | 3329590..3329787 | - | 198 | WP_197697736.1 | recombinase family protein | - |
CKV96_RS15805 | 3329875..3330015 | + | 141 | WP_154219844.1 | hypothetical protein | - |
CKV96_RS15135 | 3330040..3330543 | - | 504 | WP_027265579.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11512.36 Da Isoelectric Point: 10.3916
>T293766 WP_027266055.1 NZ_LT906476:c3325425-3325129 [Legionella pneumophila]
MIYELHFHPLALKEWKKLGKNLQEEFKKVLKRRLENPHVASASLRGSLKNCYKIKLRQSGYRLVYQVNDNKLIVTVIAVG
KRNKNVVYDDADNRQEDS
MIYELHFHPLALKEWKKLGKNLQEEFKKVLKRRLENPHVASASLRGSLKNCYKIKLRQSGYRLVYQVNDNKLIVTVIAVG
KRNKNVVYDDADNRQEDS
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|