Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prpT-prpA/CC2985(antitoxin) |
Location | 2323371..2323911 | Replicon | chromosome |
Accession | NZ_LT906476 | ||
Organism | Legionella pneumophila strain NCTC11286 |
Toxin (Protein)
Gene name | PrpT | Uniprot ID | - |
Locus tag | CKV96_RS10670 | Protein ID | WP_014844324.1 |
Coordinates | 2323615..2323911 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | PrpA | Uniprot ID | - |
Locus tag | CKV96_RS10665 | Protein ID | WP_027224835.1 |
Coordinates | 2323371..2323625 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKV96_RS10640 | 2318538..2319029 | - | 492 | WP_016356972.1 | hypothetical protein | - |
CKV96_RS10645 | 2319040..2319858 | - | 819 | WP_014326980.1 | Dam family site-specific DNA-(adenine-N6)-methyltransferase | - |
CKV96_RS10650 | 2320444..2321619 | - | 1176 | WP_027224832.1 | ISL3 family transposase | - |
CKV96_RS10655 | 2321774..2322352 | + | 579 | WP_027224833.1 | hypothetical protein | - |
CKV96_RS10660 | 2322457..2323023 | + | 567 | WP_027224834.1 | hypothetical protein | - |
CKV96_RS10665 | 2323371..2323625 | + | 255 | WP_027224835.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
CKV96_RS10670 | 2323615..2323911 | + | 297 | WP_014844324.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CKV96_RS10680 | 2324372..2325386 | - | 1015 | Protein_2044 | transposase | - |
CKV96_RS10685 | 2325649..2325858 | + | 210 | WP_010947832.1 | cold-shock protein | - |
CKV96_RS10690 | 2326098..2327504 | + | 1407 | WP_014844326.1 | ATP-dependent RNA helicase DbpA | - |
CKV96_RS10695 | 2327661..2328572 | + | 912 | WP_014844327.1 | cation diffusion facilitator family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2320444..2321619 | 1175 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11582.28 Da Isoelectric Point: 7.2728
>T293763 WP_014844324.1 NZ_LT906476:2323615-2323911 [Legionella pneumophila]
MSNKTYRLYPKAVEDLESIYLYSTNEFGIKRTEDYILAIDLSFQRLADDPLIARKCDYIRPELRAFNVGSHIIFFKTTDY
GISVIRVLHQSMDFNRHL
MSNKTYRLYPKAVEDLESIYLYSTNEFGIKRTEDYILAIDLSFQRLADDPLIARKCDYIRPELRAFNVGSHIIFFKTTDY
GISVIRVLHQSMDFNRHL
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|