Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 883072..883726 | Replicon | chromosome |
Accession | NZ_LT906474 | ||
Organism | Escherichia coli strain NCTC122 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | CKV98_RS04545 | Protein ID | WP_000244777.1 |
Coordinates | 883319..883726 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | CKV98_RS04540 | Protein ID | WP_000354046.1 |
Coordinates | 883072..883338 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKV98_RS04520 | 879041..880474 | - | 1434 | WP_001514525.1 | 6-phospho-beta-glucosidase BglA | - |
CKV98_RS04525 | 880519..880830 | + | 312 | WP_001514524.1 | N(4)-acetylcytidine aminohydrolase | - |
CKV98_RS04530 | 880994..881653 | + | 660 | WP_081508779.1 | hemolysin III family protein | - |
CKV98_RS04535 | 881849..882829 | - | 981 | WP_001514522.1 | tRNA-modifying protein YgfZ | - |
CKV98_RS04540 | 883072..883338 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
CKV98_RS04545 | 883319..883726 | + | 408 | WP_000244777.1 | toxin CptA | Toxin |
CKV98_RS04550 | 883766..884287 | - | 522 | WP_081508780.1 | flavodoxin FldB | - |
CKV98_RS04555 | 884399..885295 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
CKV98_RS04560 | 885320..886030 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
CKV98_RS04565 | 886036..887769 | + | 1734 | WP_000813201.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T293746 WP_000244777.1 NZ_LT906474:883319-883726 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QD57 |