Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Fic(toxin) |
Location | 1569188..1569765 | Replicon | chromosome |
Accession | NZ_LT906469 | ||
Organism | Mycolicibacter terrae strain NCTC10856 |
Toxin (Protein)
Gene name | doc | Uniprot ID | - |
Locus tag | CKW33_RS07310 | Protein ID | WP_085259683.1 |
Coordinates | 1569188..1569571 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | CKW33_RS07315 | Protein ID | WP_085259684.1 |
Coordinates | 1569568..1569765 (-) | Length | 66 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKW33_RS07285 | 1564832..1565875 | + | 1044 | WP_085259679.1 | heat-inducible transcriptional repressor HrcA | - |
CKW33_RS07290 | 1565909..1567060 | + | 1152 | WP_085259680.1 | molecular chaperone DnaJ | - |
CKW33_RS07295 | 1567064..1567807 | + | 744 | WP_085259681.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
CKW33_RS07300 | 1567813..1568514 | + | 702 | WP_085259682.1 | AraC family transcriptional regulator | - |
CKW33_RS07305 | 1568493..1569140 | - | 648 | WP_085259701.1 | methyltransferase domain-containing protein | - |
CKW33_RS07310 | 1569188..1569571 | - | 384 | WP_085259683.1 | Fic family protein | Toxin |
CKW33_RS07315 | 1569568..1569765 | - | 198 | WP_085259684.1 | antitoxin Phd | Antitoxin |
CKW33_RS07320 | 1569899..1570951 | + | 1053 | WP_085259685.1 | PhoH family protein | - |
CKW33_RS07325 | 1570948..1571484 | + | 537 | WP_085259686.1 | rRNA maturation RNase YbeY | - |
CKW33_RS07330 | 1571481..1572779 | + | 1299 | WP_085259687.1 | hemolysin family protein | - |
CKW33_RS07335 | 1572879..1573775 | + | 897 | WP_085259688.1 | GTPase Era | - |
CKW33_RS07340 | 1573825..1574499 | + | 675 | WP_165758668.1 | DUF5642 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13589.27 Da Isoelectric Point: 3.8561
>T293734 WP_085259683.1 NZ_LT906469:c1569571-1569188 [Mycolicibacter terrae]
MTEFLDRDDLLVAGAFAVSHACEVGDYGLLDAAVARPQATVFGVDAYPDLYAKAAALLQSLARNHALVDGNMRTAWASAW
TFLYLNACELSPDFDVDAAEVFMNDVAQRGELPVEDIAATLASFAVT
MTEFLDRDDLLVAGAFAVSHACEVGDYGLLDAAVARPQATVFGVDAYPDLYAKAAALLQSLARNHALVDGNMRTAWASAW
TFLYLNACELSPDFDVDAAEVFMNDVAQRGELPVEDIAATLASFAVT
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|