Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1585165..1585689 | Replicon | chromosome |
Accession | NZ_LT906464 | ||
Organism | Staphylococcus muscae strain NCTC13833 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | CKV93_RS07800 | Protein ID | WP_095117482.1 |
Coordinates | 1585165..1585518 (-) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | CKV93_RS07805 | Protein ID | WP_095117483.1 |
Coordinates | 1585519..1585689 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKV93_RS07780 | 1582234..1583007 | - | 774 | WP_095117478.1 | RNA polymerase sigma factor SigB | - |
CKV93_RS07785 | 1582979..1583461 | - | 483 | WP_095117479.1 | anti-sigma B factor RsbW | - |
CKV93_RS07790 | 1583463..1583789 | - | 327 | WP_095117480.1 | anti-sigma factor antagonist | - |
CKV93_RS07795 | 1583865..1584893 | - | 1029 | WP_095117481.1 | PP2C family protein-serine/threonine phosphatase | - |
CKV93_RS07800 | 1585165..1585518 | - | 354 | WP_095117482.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
CKV93_RS07805 | 1585519..1585689 | - | 171 | WP_095117483.1 | antitoxin MazE | Antitoxin |
CKV93_RS07810 | 1585778..1586926 | - | 1149 | WP_095117484.1 | alanine racemase | - |
CKV93_RS07815 | 1586954..1587313 | - | 360 | WP_095117485.1 | holo-ACP synthase | - |
CKV93_RS07820 | 1587310..1587885 | - | 576 | WP_095117486.1 | PH domain-containing protein | - |
CKV93_RS07825 | 1587875..1589380 | - | 1506 | WP_095117487.1 | PH domain-containing protein | - |
CKV93_RS07830 | 1589373..1589846 | - | 474 | WP_095117488.1 | PH domain-containing protein | - |
CKV93_RS07835 | 1589981..1590682 | - | 702 | WP_095117489.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13030.17 Da Isoelectric Point: 10.2682
>T293731 WP_095117482.1 NZ_LT906464:c1585518-1585165 [Staphylococcus muscae]
MKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRT
VDKNRLKEKLTFLSDEKMKEVNNALGISLGLQVVQSR
MKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRT
VDKNRLKEKLTFLSDEKMKEVNNALGISLGLQVVQSR
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|