Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 680745..681284 | Replicon | chromosome |
Accession | NZ_LT906462 | ||
Organism | Mammaliicoccus stepanovicii strain NCTC13839 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | CKV64_RS03325 | Protein ID | WP_095086751.1 |
Coordinates | 680913..681284 (+) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | CKV64_RS03320 | Protein ID | WP_095086748.1 |
Coordinates | 680745..680912 (+) | Length | 56 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKV64_RS03295 | 676621..677100 | + | 480 | WP_095086734.1 | PH domain-containing protein | - |
CKV64_RS03300 | 677090..678622 | + | 1533 | WP_095086737.1 | PH domain-containing protein | - |
CKV64_RS03305 | 678606..679073 | + | 468 | WP_095086740.1 | PH domain-containing protein | - |
CKV64_RS03310 | 679094..679462 | + | 369 | WP_095086743.1 | holo-ACP synthase | - |
CKV64_RS03315 | 679510..680658 | + | 1149 | WP_095086746.1 | alanine racemase | - |
CKV64_RS03320 | 680745..680912 | + | 168 | WP_095086748.1 | antitoxin MazE | Antitoxin |
CKV64_RS03325 | 680913..681284 | + | 372 | WP_095086751.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
CKV64_RS03330 | 681388..682392 | + | 1005 | WP_095086754.1 | PP2C family protein-serine/threonine phosphatase | - |
CKV64_RS03335 | 682465..682791 | + | 327 | WP_095086757.1 | anti-sigma factor antagonist | - |
CKV64_RS03340 | 682793..683269 | + | 477 | WP_095086760.1 | anti-sigma B factor RsbW | - |
CKV64_RS03345 | 683244..684014 | + | 771 | WP_095086764.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13662.84 Da Isoelectric Point: 9.9193
>T293728 WP_095086751.1 NZ_LT906462:680913-681284 [Mammaliicoccus stepanovicii]
MRRGDVYLADLSPVTGSEQGGTRPVVIIQNDTGNRYSPTVIVAAITGKINKAKIPTHVEIEAAKYKLDRDSVILLEQIRT
IDKKRLKEKLTYLSDAKMKEVDLAIAISLNLTLQHKFDTLGNT
MRRGDVYLADLSPVTGSEQGGTRPVVIIQNDTGNRYSPTVIVAAITGKINKAKIPTHVEIEAAKYKLDRDSVILLEQIRT
IDKKRLKEKLTYLSDAKMKEVDLAIAISLNLTLQHKFDTLGNT
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|