Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 2962840..2963491 | Replicon | chromosome |
Accession | NZ_LT906461 | ||
Organism | Bordetella hinzii strain NCTC13200 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | CKW36_RS13645 | Protein ID | WP_080666588.1 |
Coordinates | 2962840..2963016 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A0H4WIS4 |
Locus tag | CKW36_RS13650 | Protein ID | WP_029580464.1 |
Coordinates | 2963075..2963491 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKW36_RS13625 | 2958020..2959675 | + | 1656 | WP_029580468.1 | PAS domain-containing methyl-accepting chemotaxis protein | - |
CKW36_RS13630 | 2959814..2960302 | + | 489 | WP_029580467.1 | membrane protein | - |
CKW36_RS13635 | 2960489..2961445 | - | 957 | WP_144417577.1 | hypothetical protein | - |
CKW36_RS13640 | 2961759..2962451 | + | 693 | WP_029580465.1 | SOS response-associated peptidase family protein | - |
CKW36_RS13645 | 2962840..2963016 | + | 177 | WP_080666588.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
CKW36_RS13650 | 2963075..2963491 | + | 417 | WP_029580464.1 | antitoxin | Antitoxin |
CKW36_RS23280 | 2963491..2963988 | + | 498 | WP_144417576.1 | hypothetical protein | - |
CKW36_RS13655 | 2963964..2964470 | - | 507 | WP_080666598.1 | DUF2514 family protein | - |
CKW36_RS13660 | 2964497..2964988 | - | 492 | WP_029580462.1 | hypothetical protein | - |
CKW36_RS13665 | 2964994..2965434 | - | 441 | WP_029580461.1 | hypothetical protein | - |
CKW36_RS13670 | 2965534..2966133 | - | 600 | WP_029580460.1 | hypothetical protein | - |
CKW36_RS13675 | 2966161..2968146 | - | 1986 | WP_029580459.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2961759..3009465 | 47706 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6522.48 Da Isoelectric Point: 11.0738
>T293725 WP_080666588.1 NZ_LT906461:2962840-2963016 [Bordetella hinzii]
VKTSEFRRWLAEQGATFKEGSAHTKVYLNGKQTTLPRHGSQEIGEGLRRAILKQLGIK
VKTSEFRRWLAEQGATFKEGSAHTKVYLNGKQTTLPRHGSQEIGEGLRRAILKQLGIK
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15149.53 Da Isoelectric Point: 4.6381
>AT293725 WP_029580464.1 NZ_LT906461:2963075-2963491 [Bordetella hinzii]
MLRYPAKIAPDTVGFMVTFRDIPEALSAGQTREEAEAMAADALLVAMDFYFEDRRPVPPPSAPVGDEVMIALPASASAKV
LLLNEMLAQQVTPSELARRMETRKQEVNRIIDLNHATKIDTIAAALTSLGRELELTVR
MLRYPAKIAPDTVGFMVTFRDIPEALSAGQTREEAEAMAADALLVAMDFYFEDRRPVPPPSAPVGDEVMIALPASASAKV
LLLNEMLAQQVTPSELARRMETRKQEVNRIIDLNHATKIDTIAAALTSLGRELELTVR
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|