Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/GNAT-DUF1778 |
Location | 1640621..1641399 | Replicon | chromosome |
Accession | NZ_LT906461 | ||
Organism | Bordetella hinzii strain NCTC13200 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A0H4W6J9 |
Locus tag | CKW36_RS07505 | Protein ID | WP_029577226.1 |
Coordinates | 1640621..1641124 (-) | Length | 168 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A0H4W2N5 |
Locus tag | CKW36_RS07510 | Protein ID | WP_029577227.1 |
Coordinates | 1641121..1641399 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKW36_RS07465 | 1635720..1636190 | - | 471 | WP_029577219.1 | hypothetical protein | - |
CKW36_RS07470 | 1636187..1636399 | - | 213 | WP_029577220.1 | helix-turn-helix domain-containing protein | - |
CKW36_RS07475 | 1636588..1636812 | - | 225 | WP_029577221.1 | DUF2188 domain-containing protein | - |
CKW36_RS07480 | 1636878..1637834 | - | 957 | WP_029577222.1 | hypothetical protein | - |
CKW36_RS07485 | 1637843..1638649 | - | 807 | WP_029577223.1 | hypothetical protein | - |
CKW36_RS07490 | 1638658..1638825 | + | 168 | Protein_1478 | DUF2924 domain-containing protein | - |
CKW36_RS07495 | 1638822..1640177 | + | 1356 | WP_029577224.1 | recombinase family protein | - |
CKW36_RS07500 | 1640174..1640605 | + | 432 | WP_029577225.1 | hypothetical protein | - |
CKW36_RS07505 | 1640621..1641124 | - | 504 | WP_029577226.1 | GNAT family N-acetyltransferase | Toxin |
CKW36_RS07510 | 1641121..1641399 | - | 279 | WP_029577227.1 | DUF1778 domain-containing protein | Antitoxin |
CKW36_RS07515 | 1641848..1642126 | - | 279 | WP_029577228.1 | head-tail connector protein | - |
CKW36_RS07520 | 1642123..1642458 | - | 336 | WP_029577229.1 | phage head closure protein | - |
CKW36_RS07525 | 1642597..1644093 | - | 1497 | WP_029577230.1 | terminase | - |
CKW36_RS07530 | 1644090..1644548 | - | 459 | WP_029577231.1 | hypothetical protein | - |
CKW36_RS07535 | 1644599..1645036 | - | 438 | WP_029577232.1 | HNH endonuclease | - |
CKW36_RS07540 | 1645033..1646247 | - | 1215 | WP_029577233.1 | phage portal protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1611341..1672778 | 61437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 168 a.a. Molecular weight: 18326.13 Da Isoelectric Point: 7.2395
>T293724 WP_029577226.1 NZ_LT906461:c1641124-1640621 [Bordetella hinzii]
MSNDYSPVRKLAATDQVDAFDCGQAALNQFLQRYALINQKANSAQTYVCCQGDVVVGFYSLAVGSVDPEAAPSRVMKGLA
RHPVPVMILARLAVDKAHQCKGLGQALLKDALLRTAQAADIAGIRCLLVHAKDDAARQWYESWEFEPSPTDPYHLFLMLK
DLKSMLS
MSNDYSPVRKLAATDQVDAFDCGQAALNQFLQRYALINQKANSAQTYVCCQGDVVVGFYSLAVGSVDPEAAPSRVMKGLA
RHPVPVMILARLAVDKAHQCKGLGQALLKDALLRTAQAADIAGIRCLLVHAKDDAARQWYESWEFEPSPTDPYHLFLMLK
DLKSMLS
Download Length: 504 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H4W6J9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H4W2N5 |