Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF-doc |
Location | 2420408..2421009 | Replicon | chromosome |
Accession | NZ_LT906460 | ||
Organism | Staphylococcus simiae strain NCTC13838 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | G5JI18 |
Locus tag | CKV88_RS11380 | Protein ID | WP_002463367.1 |
Coordinates | 2420408..2420743 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | G5JI19 |
Locus tag | CKV88_RS11385 | Protein ID | WP_002463369.1 |
Coordinates | 2420740..2421009 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKV88_RS11355 | 2416406..2416840 | - | 435 | WP_002463357.1 | MarR family transcriptional regulator | - |
CKV88_RS11360 | 2417033..2417956 | - | 924 | WP_002463358.1 | zinc ABC transporter substrate-binding protein | - |
CKV88_RS11365 | 2418150..2418431 | + | 282 | WP_002463360.1 | N-acetyltransferase | - |
CKV88_RS11370 | 2418693..2419499 | + | 807 | WP_002463362.1 | VOC family protein | - |
CKV88_RS11375 | 2419569..2420231 | - | 663 | WP_002463364.1 | NAD(P)H-dependent oxidoreductase | - |
CKV88_RS11380 | 2420408..2420743 | - | 336 | WP_002463367.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
CKV88_RS11385 | 2420740..2421009 | - | 270 | WP_002463369.1 | hypothetical protein | Antitoxin |
CKV88_RS11390 | 2421728..2422720 | + | 993 | WP_002463371.1 | D-lactate dehydrogenase | - |
CKV88_RS11395 | 2422927..2423217 | - | 291 | WP_002463373.1 | hypothetical protein | - |
CKV88_RS11400 | 2423233..2424150 | - | 918 | WP_002463375.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2425159..2426238 | 1079 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12835.91 Da Isoelectric Point: 8.9154
>T293721 WP_002463367.1 NZ_LT906460:c2420743-2420408 [Staphylococcus simiae]
MSVKQFDILYIDLDPTKGREKQKIRPCLVVNNDMTIKGTNFVWILPITSREPKFPTDIEVKSKNRLITGVIDTVQIRALD
LNAREYSYRDELQDSLKNDVLLAINAFLKPQ
MSVKQFDILYIDLDPTKGREKQKIRPCLVVNNDMTIKGTNFVWILPITSREPKFPTDIEVKSKNRLITGVIDTVQIRALD
LNAREYSYRDELQDSLKNDVLLAINAFLKPQ
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|