Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2012017..2012549 | Replicon | chromosome |
Accession | NZ_LT906460 | ||
Organism | Staphylococcus simiae strain NCTC13838 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G5JLV8 |
Locus tag | CKV88_RS09370 | Protein ID | WP_002465156.1 |
Coordinates | 2012017..2012382 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G5JLV7 |
Locus tag | CKV88_RS09375 | Protein ID | WP_002465155.1 |
Coordinates | 2012379..2012549 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKV88_RS09350 | 2008225..2008995 | - | 771 | WP_002464557.1 | RNA polymerase sigma factor SigB | - |
CKV88_RS09355 | 2008970..2009449 | - | 480 | WP_002464556.1 | anti-sigma B factor RsbW | - |
CKV88_RS09360 | 2009451..2009777 | - | 327 | WP_002464555.1 | anti-sigma factor antagonist | - |
CKV88_RS09365 | 2009895..2010896 | - | 1002 | WP_002464554.1 | PP2C family protein-serine/threonine phosphatase | - |
CKV88_RS09370 | 2012017..2012382 | - | 366 | WP_002465156.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
CKV88_RS09375 | 2012379..2012549 | - | 171 | WP_002465155.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
CKV88_RS09380 | 2012634..2013782 | - | 1149 | WP_002465154.1 | alanine racemase | - |
CKV88_RS09385 | 2013846..2014202 | - | 357 | WP_002465153.1 | holo-ACP synthase | - |
CKV88_RS09390 | 2014250..2014723 | - | 474 | WP_002465152.1 | PH domain-containing protein | - |
CKV88_RS09395 | 2014710..2016266 | - | 1557 | WP_002465151.1 | PH domain-containing protein | - |
CKV88_RS09400 | 2016259..2016738 | - | 480 | WP_002465150.1 | PH domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13514.85 Da Isoelectric Point: 10.2631
>T293719 WP_002465156.1 NZ_LT906460:c2012382-2012017 [Staphylococcus simiae]
MIKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSESKMKEVDNALIISLGLTTLSQHKLS
MIKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSESKMKEVDNALIISLGLTTLSQHKLS
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|