Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1850416..1851192 | Replicon | chromosome |
Accession | NZ_LT906460 | ||
Organism | Staphylococcus simiae strain NCTC13838 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | - |
Locus tag | CKV88_RS08545 | Protein ID | WP_002461710.1 |
Coordinates | 1850416..1850571 (-) | Length | 52 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | G5JFE6 |
Locus tag | CKV88_RS08550 | Protein ID | WP_002461709.1 |
Coordinates | 1850593..1851192 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKV88_RS08525 | 1845583..1846704 | - | 1122 | WP_002461714.1 | GAF domain-containing sensor histidine kinase | - |
CKV88_RS08530 | 1846863..1847684 | + | 822 | WP_095092771.1 | RluA family pseudouridine synthase | - |
CKV88_RS08535 | 1848296..1849681 | - | 1386 | WP_002461712.1 | class II fumarate hydratase | - |
CKV88_RS08540 | 1849863..1850264 | - | 402 | WP_002461711.1 | hypothetical protein | - |
CKV88_RS08545 | 1850416..1850571 | - | 156 | WP_002461710.1 | hypothetical protein | Toxin |
CKV88_RS08550 | 1850593..1851192 | - | 600 | WP_002461709.1 | hypothetical protein | Antitoxin |
CKV88_RS08555 | 1851486..1851956 | - | 471 | WP_002461708.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
CKV88_RS08560 | 1851958..1853088 | - | 1131 | WP_002461707.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
CKV88_RS08565 | 1853231..1853953 | - | 723 | Protein_1664 | amino acid ABC transporter ATP-binding protein | - |
CKV88_RS08570 | 1853946..1855403 | - | 1458 | WP_002461705.1 | ABC transporter substrate-binding protein/permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 6085.35 Da Isoelectric Point: 4.0406
>T293718 WP_002461710.1 NZ_LT906460:c1850571-1850416 [Staphylococcus simiae]
MFNEKDAKSNYHEDENAMVNDFDDLKELGKEMEQISEENDQEKHNQSHDNN
MFNEKDAKSNYHEDENAMVNDFDDLKELGKEMEQISEENDQEKHNQSHDNN
Download Length: 156 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22446.33 Da Isoelectric Point: 4.6276
>AT293718 WP_002461709.1 NZ_LT906460:c1851192-1850593 [Staphylococcus simiae]
MAMNFKVFDNSQLVADYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVDHYAVDFSQINILDYDNNQSYFEALGV
PESQIYAIGFEKDAIEFISDKIKTKENKGKLTLQVLSISEQGNLDVSVRQGLMEAREIILVITGSNKRGLVEKLYQENGK
TSYEPADLKAHRMVNVILDKEAAEGLPEDVKTYFTSRFA
MAMNFKVFDNSQLVADYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVDHYAVDFSQINILDYDNNQSYFEALGV
PESQIYAIGFEKDAIEFISDKIKTKENKGKLTLQVLSISEQGNLDVSVRQGLMEAREIILVITGSNKRGLVEKLYQENGK
TSYEPADLKAHRMVNVILDKEAAEGLPEDVKTYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|