Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hipA-higA/HipA-HTH_31 |
Location | 81368..82934 | Replicon | chromosome |
Accession | NZ_LT906457 | ||
Organism | Legionella spiritensis strain NCTC11990 |
Toxin (Protein)
Gene name | hipA | Uniprot ID | - |
Locus tag | CKW05_RS00415 | Protein ID | WP_095140518.1 |
Coordinates | 81639..82934 (-) | Length | 432 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | CKW05_RS00410 | Protein ID | WP_095140675.1 |
Coordinates | 81368..81544 (-) | Length | 59 a.a. |
Genomic Context
Location: 77648..78217 (570 bp)
Type: Others
Protein ID: WP_133141164.1
Type: Others
Protein ID: WP_133141164.1
Location: 78578..80620 (2043 bp)
Type: Others
Protein ID: WP_058484807.1
Type: Others
Protein ID: WP_058484807.1
Location: 85074..85586 (513 bp)
Type: Others
Protein ID: WP_058484721.1
Type: Others
Protein ID: WP_058484721.1
Location: 80839..81029 (191 bp)
Type: Others
Protein ID: Protein_76
Type: Others
Protein ID: Protein_76
Location: 81368..81544 (177 bp)
Type: Antitoxin
Protein ID: WP_095140675.1
Type: Antitoxin
Protein ID: WP_095140675.1
Location: 81639..82934 (1296 bp)
Type: Toxin
Protein ID: WP_095140518.1
Type: Toxin
Protein ID: WP_095140518.1
Location: 82921..83202 (282 bp)
Type: Others
Protein ID: WP_058484723.1
Type: Others
Protein ID: WP_058484723.1
Location: 83326..84531 (1206 bp)
Type: Others
Protein ID: WP_058484722.1
Type: Others
Protein ID: WP_058484722.1
Location: 85776..87920 (2145 bp)
Type: Others
Protein ID: WP_058484720.1
Type: Others
Protein ID: WP_058484720.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKW05_RS00390 | 77648..78217 | + | 570 | WP_133141164.1 | hypothetical protein | - |
CKW05_RS00395 | 78578..80620 | + | 2043 | WP_058484807.1 | diguanylate cyclase | - |
CKW05_RS00400 | 80839..81029 | - | 191 | Protein_76 | hypothetical protein | - |
CKW05_RS00410 | 81368..81544 | - | 177 | WP_095140675.1 | helix-turn-helix domain-containing protein | Antitoxin |
CKW05_RS00415 | 81639..82934 | - | 1296 | WP_095140518.1 | HipA domain-containing protein | Toxin |
CKW05_RS00420 | 82921..83202 | - | 282 | WP_058484723.1 | helix-turn-helix domain-containing protein | - |
CKW05_RS00425 | 83326..84531 | - | 1206 | WP_058484722.1 | site-specific integrase | - |
CKW05_RS00430 | 85074..85586 | + | 513 | WP_058484721.1 | hypothetical protein | - |
CKW05_RS00435 | 85776..87920 | - | 2145 | WP_058484720.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 79896..326704 | 246808 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 432 a.a. Molecular weight: 49058.04 Da Isoelectric Point: 6.4000
>T293711 WP_095140518.1 NZ_LT906457:c82934-81639 [Legionella spiritensis]
MIGSEHVLDVYLGDNIIAELSLVNDQLHWHYRPDWQQNGYPVSPHLPLDREIPPLNVTRFLRNLLPEGNALEELINTFHL
SKGNTFGLVRALGLDTPGSLVFRSPTQSSPIKTSFRPVLDKELEQRLDSRDEFSLIIWDGKPRLSVAGVQDKINVVLNEE
NQLGFGEGNLCSTHILKFEKQKLAHLVLNEYVTMRLARLCGLNVANAKLLCYGKNPALLVERFDRHFISLTEVKRRHMID
GCQALNVPPDYKYERNFGSGRDVAHIRDGVSLEKLFEFANQCENPALAKQRMLDWVLFNTLIFNCDAHGKNISFFVGSKG
LSLTPFYDLVNIKMYPEFEHDLAMALGDEFDENNVNAYQLADFADTCQLPRSFVTNRLKYLGKKLSASVGECHSAGINDD
ERAYLHHYKKMIQERCNHLLKEADGIVSMEL
MIGSEHVLDVYLGDNIIAELSLVNDQLHWHYRPDWQQNGYPVSPHLPLDREIPPLNVTRFLRNLLPEGNALEELINTFHL
SKGNTFGLVRALGLDTPGSLVFRSPTQSSPIKTSFRPVLDKELEQRLDSRDEFSLIIWDGKPRLSVAGVQDKINVVLNEE
NQLGFGEGNLCSTHILKFEKQKLAHLVLNEYVTMRLARLCGLNVANAKLLCYGKNPALLVERFDRHFISLTEVKRRHMID
GCQALNVPPDYKYERNFGSGRDVAHIRDGVSLEKLFEFANQCENPALAKQRMLDWVLFNTLIFNCDAHGKNISFFVGSKG
LSLTPFYDLVNIKMYPEFEHDLAMALGDEFDENNVNAYQLADFADTCQLPRSFVTNRLKYLGKKLSASVGECHSAGINDD
ERAYLHHYKKMIQERCNHLLKEADGIVSMEL
Download Length: 1296 bp