Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higB-toxA/Tad-couple_hipB |
| Location | 2430435..2431077 | Replicon | chromosome |
| Accession | NZ_LT906456 | ||
| Organism | Actinobacillus suis strain NCTC12996 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | K0GF68 |
| Locus tag | CKV75_RS11375 | Protein ID | WP_005621659.1 |
| Coordinates | 2430435..2430806 (+) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | toxA | Uniprot ID | - |
| Locus tag | CKV75_RS11380 | Protein ID | WP_005621656.1 |
| Coordinates | 2430787..2431077 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CKV75_RS11360 | 2426940..2427794 | + | 855 | WP_015674480.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
| CKV75_RS11365 | 2427838..2428407 | - | 570 | WP_005608594.1 | elongation factor P hydroxylase | - |
| CKV75_RS11370 | 2428466..2430217 | - | 1752 | WP_015674481.1 | protein-disulfide reductase DsbD | - |
| CKV75_RS11375 | 2430435..2430806 | + | 372 | WP_005621659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| CKV75_RS11380 | 2430787..2431077 | + | 291 | WP_005621656.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| CKV75_RS11385 | 2431145..2432107 | - | 963 | WP_015674482.1 | calcium/sodium antiporter | - |
| CKV75_RS11390 | 2432180..2432677 | + | 498 | WP_015674483.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
| CKV75_RS11395 | 2432905..2433639 | + | 735 | WP_015674484.1 | arginine ABC transporter ATP-binding protein ArtP | - |
| CKV75_RS11400 | 2433659..2434378 | + | 720 | WP_015674485.1 | transporter substrate-binding domain-containing protein | - |
| CKV75_RS11405 | 2434384..2435055 | + | 672 | WP_015674486.1 | arginine ABC transporter permease ArtQ | - |
| CKV75_RS11410 | 2435055..2435738 | + | 684 | WP_015674487.1 | arginine ABC transporter permease ArtM | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14938.10 Da Isoelectric Point: 9.5717
>T293710 WP_005621659.1 NZ_LT906456:2430435-2430806 [Actinobacillus suis]
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|