Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1930996..1931727 | Replicon | chromosome |
| Accession | NZ_LT906456 | ||
| Organism | Actinobacillus suis strain NCTC12996 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | K0FZ70 |
| Locus tag | CKV75_RS08910 | Protein ID | WP_015674046.1 |
| Coordinates | 1930996..1931463 (-) | Length | 156 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | K0G6P2 |
| Locus tag | CKV75_RS08915 | Protein ID | WP_015674047.1 |
| Coordinates | 1931467..1931727 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CKV75_RS08895 | 1926938..1928314 | + | 1377 | WP_015674043.1 | Trk system potassium transporter TrkA | - |
| CKV75_RS08900 | 1928527..1929921 | + | 1395 | WP_015674044.1 | class II fumarate hydratase | - |
| CKV75_RS08905 | 1930032..1930913 | - | 882 | WP_015674045.1 | 50S ribosomal protein L11 methyltransferase | - |
| CKV75_RS08910 | 1930996..1931463 | - | 468 | WP_015674046.1 | GNAT family N-acetyltransferase | Toxin |
| CKV75_RS08915 | 1931467..1931727 | - | 261 | WP_015674047.1 | DUF1778 domain-containing protein | Antitoxin |
| CKV75_RS08920 | 1931848..1933308 | - | 1461 | WP_015674048.1 | metalloprotease TldD | - |
| CKV75_RS08925 | 1933438..1934697 | + | 1260 | WP_015674049.1 | tRNA lysidine(34) synthetase TilS | - |
| CKV75_RS08930 | 1934798..1935298 | - | 501 | WP_015674050.1 | thiol peroxidase | - |
| CKV75_RS08935 | 1935431..1936156 | + | 726 | WP_015674051.1 | 1-acylglycerol-3-phosphate O-acyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 156 a.a. Molecular weight: 17157.14 Da Isoelectric Point: 8.9515
>T293707 WP_015674046.1 NZ_LT906456:c1931463-1930996 [Actinobacillus suis]
MHAPELLSEQHIVQHFQCGEVVLDQWLQRTALKNQQNNASKTFVVCDENKQVMGFYCLSAGSVSRQFVAGALRRNMPDPI
PVIILGRLAVDCSAQGKQLGVSMLKDAVLKSKTVANQIGVKALLVHALNPQAKQFYLKYGFSCSPIDEMVLMLKL
MHAPELLSEQHIVQHFQCGEVVLDQWLQRTALKNQQNNASKTFVVCDENKQVMGFYCLSAGSVSRQFVAGALRRNMPDPI
PVIILGRLAVDCSAQGKQLGVSMLKDAVLKSKTVANQIGVKALLVHALNPQAKQFYLKYGFSCSPIDEMVLMLKL
Download Length: 468 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|