Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-YefM |
| Location | 90005..90714 | Replicon | chromosome |
| Accession | NZ_LT906456 | ||
| Organism | Actinobacillus suis strain NCTC12996 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | K0G9D3 |
| Locus tag | CKV75_RS00495 | Protein ID | WP_014990917.1 |
| Coordinates | 90292..90714 (+) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | K0G3K1 |
| Locus tag | CKV75_RS00490 | Protein ID | WP_014990916.1 |
| Coordinates | 90005..90292 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CKV75_RS00475 | 85404..86585 | + | 1182 | WP_014990913.1 | bifunctional tRNA (adenosine(37)-C2)-methyltransferase TrmG/ribosomal RNA large subunit methyltransferase RlmN | - |
| CKV75_RS00480 | 86640..87188 | + | 549 | WP_014990914.1 | type IV pilus biogenesis/stability protein PilW | - |
| CKV75_RS00485 | 87264..89603 | + | 2340 | WP_014990915.1 | RNA-binding transcriptional accessory protein | - |
| CKV75_RS00490 | 90005..90292 | + | 288 | WP_014990916.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| CKV75_RS00495 | 90292..90714 | + | 423 | WP_014990917.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| CKV75_RS00500 | 91089..92369 | - | 1281 | WP_014990918.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| CKV75_RS00505 | 92481..92999 | - | 519 | WP_179130574.1 | SprT family zinc-dependent metalloprotease | - |
| CKV75_RS00510 | 93000..93770 | - | 771 | WP_014990920.1 | ribonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16233.07 Da Isoelectric Point: 9.0431
>T293704 WP_014990917.1 NZ_LT906456:90292-90714 [Actinobacillus suis]
MYLLDTNIVSELRKMESGKADVNVVAWFQQVNLTDAYLSVITLFEIKLGILQLKRKDIQQAKLLQSWFEQKLLHHFENRI
LPLDTKVMMICAEFHIPDKKPLNDSYIAATAKAHRFKIVTRNVKNFKGCGVEVLNPFIDE
MYLLDTNIVSELRKMESGKADVNVVAWFQQVNLTDAYLSVITLFEIKLGILQLKRKDIQQAKLLQSWFEQKLLHHFENRI
LPLDTKVMMICAEFHIPDKKPLNDSYIAATAKAHRFKIVTRNVKNFKGCGVEVLNPFIDE
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|