Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 1216159..1216634 | Replicon | chromosome |
Accession | NZ_LT906454 | ||
Organism | Streptococcus acidominimus strain NCTC11291 |
Toxin (Protein)
Gene name | relE | Uniprot ID | V6Z0S2 |
Locus tag | CKV85_RS05955 | Protein ID | WP_017769462.1 |
Coordinates | 1216159..1216422 (-) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V6Z151 |
Locus tag | CKV85_RS05960 | Protein ID | WP_017769463.1 |
Coordinates | 1216419..1216634 (-) | Length | 72 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKV85_RS05935 | 1212146..1212637 | + | 492 | WP_017769385.1 | PASTA domain-containing protein | - |
CKV85_RS05940 | 1212840..1214126 | - | 1287 | WP_172843176.1 | IS110 family transposase | - |
CKV85_RS05945 | 1214362..1214655 | - | 294 | Protein_1172 | MetQ/NlpA family ABC transporter substrate-binding protein | - |
CKV85_RS05950 | 1214728..1215732 | + | 1005 | WP_095122758.1 | IS5 family transposase | - |
CKV85_RS05955 | 1216159..1216422 | - | 264 | WP_017769462.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CKV85_RS05960 | 1216419..1216634 | - | 216 | WP_017769463.1 | hypothetical protein | Antitoxin |
CKV85_RS05965 | 1217259..1218428 | - | 1170 | WP_095122760.1 | ATP-grasp domain-containing protein | - |
CKV85_RS05970 | 1218450..1219196 | - | 747 | WP_095122763.1 | esterase family protein | - |
CKV85_RS05975 | 1219218..1220042 | - | 825 | WP_095122765.1 | alpha/beta hydrolase | - |
CKV85_RS05980 | 1220144..1221016 | - | 873 | Protein_1179 | winged helix DNA-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10396.92 Da Isoelectric Point: 10.1763
>T293701 WP_017769462.1 NZ_LT906454:c1216422-1216159 [Streptococcus acidominimus]
MIYQVRLTSKADKQLRKLDAYTRNTILAWIKKNLYQTDNPRLHGKGLTANHSGEWRYRVGNYRILANIYDDEIVIEIFTI
GHRRDIY
MIYQVRLTSKADKQLRKLDAYTRNTILAWIKKNLYQTDNPRLHGKGLTANHSGEWRYRVGNYRILANIYDDEIVIEIFTI
GHRRDIY
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|