Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 315676..316288 | Replicon | chromosome |
| Accession | NZ_LT906454 | ||
| Organism | Streptococcus acidominimus strain NCTC11291 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | CKV85_RS01565 | Protein ID | WP_095121639.1 |
| Coordinates | 315676..316011 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | V6Z120 |
| Locus tag | CKV85_RS01570 | Protein ID | WP_017769573.1 |
| Coordinates | 316001..316288 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CKV85_RS01545 | 311846..312689 | + | 844 | Protein_283 | replication initiation protein | - |
| CKV85_RS01550 | 312725..313159 | + | 435 | WP_095121635.1 | hypothetical protein | - |
| CKV85_RS01555 | 313476..314731 | + | 1256 | Protein_285 | plasmid recombination protein | - |
| CKV85_RS01560 | 314904..315377 | + | 474 | WP_095121637.1 | hypothetical protein | - |
| CKV85_RS01565 | 315676..316011 | - | 336 | WP_095121639.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| CKV85_RS01570 | 316001..316288 | - | 288 | WP_017769573.1 | hypothetical protein | Antitoxin |
| CKV85_RS01575 | 316634..316995 | + | 362 | Protein_289 | transposase | - |
| CKV85_RS01580 | 317034..317282 | + | 249 | WP_095123687.1 | hypothetical protein | - |
| CKV85_RS01585 | 317592..319136 | + | 1545 | WP_095121641.1 | type I restriction-modification system subunit M | - |
| CKV85_RS01590 | 319138..320346 | + | 1209 | WP_172843136.1 | restriction endonuclease subunit S | - |
| CKV85_RS11775 | 320351..320887 | + | 537 | WP_172843137.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 307048..326970 | 19922 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13228.05 Da Isoelectric Point: 5.2217
>T293700 WP_095121639.1 NZ_LT906454:c316011-315676 [Streptococcus acidominimus]
MDYKKYQIIYAPDILEKLKEIHDYISQNYSSISAQHKMEQIISDIEKLEVFPEVGFDADEKYGSKISKYHSTRGYTLSKD
YIVLYHIEEEEGRVVIDYLLPTRSDYMKLFK
MDYKKYQIIYAPDILEKLKEIHDYISQNYSSISAQHKMEQIISDIEKLEVFPEVGFDADEKYGSKISKYHSTRGYTLSKD
YIVLYHIEEEEGRVVIDYLLPTRSDYMKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|