Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1042190..1042704 | Replicon | chromosome |
| Accession | NZ_LT906447 | ||
| Organism | Staphylococcus piscifermentans strain NCTC13836 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A3G4R0E2 |
| Locus tag | CKV71_RS04670 | Protein ID | WP_075140914.1 |
| Coordinates | 1042354..1042704 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | B9DMI8 |
| Locus tag | CKV71_RS04665 | Protein ID | WP_015900820.1 |
| Coordinates | 1042190..1042357 (+) | Length | 56 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CKV71_RS04640 | 1038184..1038573 | + | 390 | WP_167376363.1 | PH domain-containing protein | - |
| CKV71_RS04645 | 1038566..1040047 | + | 1482 | WP_095104342.1 | PH domain-containing protein | - |
| CKV71_RS04650 | 1040052..1040537 | + | 486 | WP_095107238.1 | PH domain-containing protein | - |
| CKV71_RS04655 | 1040539..1040892 | + | 354 | WP_095104344.1 | holo-ACP synthase | - |
| CKV71_RS04660 | 1040955..1042109 | + | 1155 | WP_095104346.1 | alanine racemase | - |
| CKV71_RS04665 | 1042190..1042357 | + | 168 | WP_015900820.1 | hypothetical protein | Antitoxin |
| CKV71_RS04670 | 1042354..1042704 | + | 351 | WP_075140914.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| CKV71_RS04675 | 1043018..1044019 | + | 1002 | WP_095104348.1 | PP2C family protein-serine/threonine phosphatase | - |
| CKV71_RS04680 | 1044095..1044421 | + | 327 | WP_095104350.1 | anti-sigma factor antagonist | - |
| CKV71_RS04685 | 1044423..1044902 | + | 480 | WP_095104352.1 | anti-sigma B factor RsbW | - |
| CKV71_RS04690 | 1044877..1045647 | + | 771 | WP_047133044.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13075.18 Da Isoelectric Point: 10.0708
>T293694 WP_075140914.1 NZ_LT906447:1042354-1042704 [Staphylococcus piscifermentans]
MMRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKSKYKLDKDSVILLEQIR
TVDKKRLKEKLTYLSDEKMKEIDNAIQISLGLTHRN
MMRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKSKYKLDKDSVILLEQIR
TVDKKRLKEKLTYLSDEKMKEIDNAIQISLGLTHRN
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3G4R0E2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A380F5Y4 |