Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1982661..1983313 Replicon chromosome
Accession NZ_LT906445
Organism Veillonella parvula strain NCTC11810

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag CKV63_RS08900 Protein ID WP_012864932.1
Coordinates 1983128..1983313 (-) Length 62 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID D1BPU6
Locus tag CKV63_RS08895 Protein ID WP_012864931.1
Coordinates 1982661..1983059 (-) Length 133 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CKV63_RS08870 1979560..1980189 - 630 WP_012864926.1 superoxide dismutase -
CKV63_RS08875 1980550..1981089 - 540 WP_012864927.1 cysteine hydrolase -
CKV63_RS08880 1981153..1981665 - 513 WP_012864928.1 phosphatidylglycerophosphatase A -
CKV63_RS08885 1981679..1982071 - 393 WP_012864929.1 hypothetical protein -
CKV63_RS08890 1982173..1982517 - 345 WP_012864930.1 alkylphosphonate utilization protein -
CKV63_RS08895 1982661..1983059 - 399 WP_012864931.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
CKV63_RS08900 1983128..1983313 - 186 WP_012864932.1 type II toxin-antitoxin system HicA family toxin Toxin
CKV63_RS08905 1983403..1983762 - 360 WP_012864933.1 MerR family transcriptional regulator -
CKV63_RS08910 1983829..1984206 + 378 WP_012864934.1 carboxymuconolactone decarboxylase family protein -
CKV63_RS08915 1984706..1985203 - 498 WP_012864936.1 ECF transporter S component -
CKV63_RS08920 1985436..1986002 + 567 WP_012864937.1 NAD(P)H-dependent oxidoreductase -
CKV63_RS08925 1986140..1986427 - 288 WP_012864938.1 DUF2695 domain-containing protein -
CKV63_RS08930 1986441..1986947 - 507 WP_012864939.1 YfbM family protein -
CKV63_RS08935 1987051..1987644 - 594 WP_012864940.1 hypothetical protein -
CKV63_RS08940 1987674..1988045 - 372 Protein_1723 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-60)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(6-111)


Sequences

Toxin        


Download         Length: 62 a.a.        Molecular weight: 7038.46 Da        Isoelectric Point: 10.8174

>T293691 WP_012864932.1 NZ_LT906445:c1983313-1983128 [Veillonella parvula]
MTTPKELMKDLKKDGWYIDRIKGSHHILKHPIKAGRVTIPLHKEDLKPKTLQTILKQAGLK

Download         Length: 186 bp

Antitoxin


Download         Length: 133 a.a.        Molecular weight: 15072.06 Da        Isoelectric Point: 4.2501

>AT293691 WP_012864931.1 NZ_LT906445:c1983059-1982661 [Veillonella parvula]
MRKEMYPAIFSTDGKNGYTVSFPDLLGCVTEGDTLCEAVEMAEDALGIYLYSLSEDGEEFPEASNPIDIKCNKGEFIDLV
KWDEEEYLKRTDNKAVKKTLTIPSWLNHKAEEKQLNFSQILQRALKQELELV

Download         Length: 399 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB D1BPU6

References