Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemK-mazE/MazF(toxin) |
Location | 903283..903912 | Replicon | chromosome |
Accession | NZ_LT906444 | ||
Organism | Listeria welshimeri strain NCTC11857 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A6Z2PJ29 |
Locus tag | CKV90_RS04475 | Protein ID | WP_031695189.1 |
Coordinates | 903565..903912 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A7U7S1X0 |
Locus tag | CKV90_RS04470 | Protein ID | WP_003766128.1 |
Coordinates | 903283..903561 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKV90_RS04450 | 898585..900066 | + | 1482 | WP_011701701.1 | PH domain-containing protein | - |
CKV90_RS04455 | 900215..901603 | + | 1389 | WP_011701702.1 | protoporphyrinogen oxidase | - |
CKV90_RS04460 | 901596..901952 | + | 357 | WP_011701703.1 | holo-ACP synthase | - |
CKV90_RS04465 | 901971..903077 | + | 1107 | WP_011701704.1 | alanine racemase | - |
CKV90_RS04470 | 903283..903561 | + | 279 | WP_003766128.1 | CopG family ribbon-helix-helix protein | Antitoxin |
CKV90_RS04475 | 903565..903912 | + | 348 | WP_031695189.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
CKV90_RS04480 | 904160..904996 | + | 837 | WP_011701705.1 | STAS domain-containing protein | - |
CKV90_RS04485 | 905002..905358 | + | 357 | WP_003721457.1 | STAS domain-containing protein | - |
CKV90_RS04490 | 905361..905771 | + | 411 | WP_011701706.1 | anti-sigma regulatory factor | - |
CKV90_RS04495 | 905788..906792 | + | 1005 | WP_011701707.1 | PP2C family protein-serine/threonine phosphatase | - |
CKV90_RS04500 | 906941..907285 | + | 345 | WP_011701708.1 | anti sigma b factor antagonist RsbV | - |
CKV90_RS04505 | 907269..907742 | + | 474 | WP_011701709.1 | anti-sigma B factor RsbW | - |
CKV90_RS04510 | 907720..908499 | + | 780 | WP_011701710.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12801.89 Da Isoelectric Point: 7.2038
>T293690 WP_031695189.1 NZ_LT906444:903565-903912 [Listeria welshimeri]
MMVKRGDVYYADLSPVVGSEQGGIRPVLIIQNDIGNRFSPTVIVAAITAKIQKAKLPTHVEATRKDGFERDSVILLEQIR
TIDKQRLTDKITHLDEELMAKVNKALEVSLGVVEF
MMVKRGDVYYADLSPVVGSEQGGIRPVLIIQNDIGNRFSPTVIVAAITAKIQKAKLPTHVEATRKDGFERDSVILLEQIR
TIDKQRLTDKITHLDEELMAKVNKALEVSLGVVEF
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6Z2PJ29 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U7S1X0 |