Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prpT-prpA/CC2985(antitoxin) |
Location | 2454039..2454579 | Replicon | chromosome |
Accession | NZ_LT906442 | ||
Organism | Legionella waltersii strain NCTC13017 |
Toxin (Protein)
Gene name | PrpT | Uniprot ID | A0A0W1AP15 |
Locus tag | CKW04_RS11335 | Protein ID | WP_058478937.1 |
Coordinates | 2454283..2454579 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | PrpA | Uniprot ID | A0A0W1AP56 |
Locus tag | CKW04_RS11330 | Protein ID | WP_014844323.1 |
Coordinates | 2454039..2454293 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKW04_RS11300 | 2449609..2450907 | + | 1299 | WP_058478940.1 | hydroxymethylglutaryl-CoA reductase, degradative | - |
CKW04_RS11305 | 2450904..2451782 | + | 879 | WP_058478939.1 | hypothetical protein | - |
CKW04_RS11325 | 2452435..2453766 | + | 1332 | WP_058478938.1 | hypothetical protein | - |
CKW04_RS11330 | 2454039..2454293 | + | 255 | WP_014844323.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
CKW04_RS11335 | 2454283..2454579 | + | 297 | WP_058478937.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CKW04_RS11340 | 2454844..2458953 | - | 4110 | WP_058478936.1 | ankyrin repeat domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11551.17 Da Isoelectric Point: 6.4763
>T293687 WP_058478937.1 NZ_LT906442:2454283-2454579 [Legionella waltersii]
MSNKTYRLYPKAVEDLESIYLYSTNEFGIKQTEDYILTIDLSFQRLADDPVIARKCDYIRPELHAFNVGSHIIFFKTTDY
GISVIRVLHQSMDFNRHL
MSNKTYRLYPKAVEDLESIYLYSTNEFGIKQTEDYILTIDLSFQRLADDPVIARKCDYIRPELHAFNVGSHIIFFKTTDY
GISVIRVLHQSMDFNRHL
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0W1AP15 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0W1AP56 |