Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/MazF-ParD |
Location | 56351..56898 | Replicon | chromosome |
Accession | NZ_LT906441 | ||
Organism | Cutibacterium granulosum strain NCTC11865 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | CKV91_RS00280 | Protein ID | WP_065860579.1 |
Coordinates | 56351..56662 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | U1EU05 |
Locus tag | CKV91_RS00285 | Protein ID | WP_021104869.1 |
Coordinates | 56665..56898 (-) | Length | 78 a.a. |
Genomic Context
Location: 52589..56071 (3483 bp)
Type: Others
Protein ID: WP_021105015.1
Type: Others
Protein ID: WP_021105015.1
Location: 56351..56662 (312 bp)
Type: Toxin
Protein ID: WP_065860579.1
Type: Toxin
Protein ID: WP_065860579.1
Location: 56665..56898 (234 bp)
Type: Antitoxin
Protein ID: WP_021104869.1
Type: Antitoxin
Protein ID: WP_021104869.1
Location: 57135..57530 (396 bp)
Type: Others
Protein ID: WP_023034352.1
Type: Others
Protein ID: WP_023034352.1
Location: 57544..58155 (612 bp)
Type: Others
Protein ID: WP_021105018.1
Type: Others
Protein ID: WP_021105018.1
Location: 58590..59288 (699 bp)
Type: Others
Protein ID: WP_021104866.1
Type: Others
Protein ID: WP_021104866.1
Location: 59375..59806 (432 bp)
Type: Others
Protein ID: WP_065860437.1
Type: Others
Protein ID: WP_065860437.1
Location: 60069..61001 (933 bp)
Type: Others
Protein ID: WP_065860436.1
Type: Others
Protein ID: WP_065860436.1
Location: 61027..61272 (246 bp)
Type: Others
Protein ID: WP_197691367.1
Type: Others
Protein ID: WP_197691367.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKV91_RS00275 | 52589..56071 | - | 3483 | WP_021105015.1 | DNA-directed RNA polymerase subunit beta | - |
CKV91_RS00280 | 56351..56662 | - | 312 | WP_065860579.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
CKV91_RS00285 | 56665..56898 | - | 234 | WP_021104869.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
CKV91_RS00290 | 57135..57530 | - | 396 | WP_023034352.1 | 50S ribosomal protein L7/L12 | - |
CKV91_RS00295 | 57544..58155 | - | 612 | WP_021105018.1 | 50S ribosomal protein L10 | - |
CKV91_RS00300 | 58590..59288 | - | 699 | WP_021104866.1 | 50S ribosomal protein L1 | - |
CKV91_RS00305 | 59375..59806 | - | 432 | WP_065860437.1 | 50S ribosomal protein L11 | - |
CKV91_RS00310 | 60069..61001 | - | 933 | WP_065860436.1 | transcription termination/antitermination protein NusG | - |
CKV91_RS09530 | 61027..61272 | - | 246 | WP_197691367.1 | preprotein translocase subunit SecE | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11264.21 Da Isoelectric Point: 8.5380
>T293685 WP_065860579.1 NZ_LT906441:c56662-56351 [Cutibacterium granulosum]
MREICLARMDRTRPVVVLTREVSRQAMTKVTVAPVTSTIKGLCSEVRVGKANGLDHESAIALDNVLTIPVDRLGRSIGFL
TPDQEKALARAFVMAYDLELPVA
MREICLARMDRTRPVVVLTREVSRQAMTKVTVAPVTSTIKGLCSEVRVGKANGLDHESAIALDNVLTIPVDRLGRSIGFL
TPDQEKALARAFVMAYDLELPVA
Download Length: 312 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | U1EU05 |