Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 528639..529275 | Replicon | chromosome |
Accession | NZ_LT906438 | ||
Organism | Bacillus pumilus strain NCTC10337 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | K2MHT4 |
Locus tag | CKW02_RS02580 | Protein ID | WP_003214169.1 |
Coordinates | 528925..529275 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | W8QJ31 |
Locus tag | CKW02_RS02575 | Protein ID | WP_003214273.1 |
Coordinates | 528639..528920 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKW02_RS02555 | 524786..525391 | - | 606 | WP_003214209.1 | rhomboid family intramembrane serine protease | - |
CKW02_RS02560 | 525486..525851 | + | 366 | WP_003214420.1 | holo-ACP synthase | - |
CKW02_RS02565 | 526012..527028 | + | 1017 | WP_095117747.1 | outer membrane lipoprotein carrier protein LolA | - |
CKW02_RS02570 | 527164..528345 | + | 1182 | WP_003214072.1 | alanine racemase | - |
CKW02_RS02575 | 528639..528920 | + | 282 | WP_003214273.1 | hypothetical protein | Antitoxin |
CKW02_RS02580 | 528925..529275 | + | 351 | WP_003214169.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
CKW02_RS02585 | 529390..530220 | + | 831 | WP_003214372.1 | STAS domain-containing protein | - |
CKW02_RS02590 | 530225..530593 | + | 369 | WP_003214235.1 | RsbT antagonist protein RsbS | - |
CKW02_RS02595 | 530596..530997 | + | 402 | WP_003214085.1 | anti-sigma regulatory factor | - |
CKW02_RS02600 | 531008..532015 | + | 1008 | WP_003213895.1 | PP2C family protein-serine/threonine phosphatase | - |
CKW02_RS02605 | 532075..532404 | + | 330 | WP_003213847.1 | anti-sigma factor antagonist | - |
CKW02_RS02610 | 532401..532889 | + | 489 | WP_003214356.1 | anti-sigma B factor RsbW | - |
CKW02_RS02615 | 532855..533643 | + | 789 | WP_003214304.1 | RNA polymerase sigma factor SigB | - |
CKW02_RS02620 | 533643..534242 | + | 600 | WP_003214034.1 | SpoIIE family protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12976.99 Da Isoelectric Point: 5.1663
>T293683 WP_003214169.1 NZ_LT906438:528925-529275 [Bacillus pumilus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | K2MHT4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A081L854 |