Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1538248..1538933 Replicon chromosome
Accession NZ_LT906437
Organism Neisseria gonorrhoeae strain NCTC13799

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag CKV86_RS09090 Protein ID WP_003689143.1
Coordinates 1538751..1538933 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag CKV86_RS09085 Protein ID WP_003691454.1
Coordinates 1538248..1538649 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CKV86_RS09030 1533298..1533513 - 216 WP_003691538.1 hypothetical protein -
CKV86_RS09035 1533565..1534056 - 492 WP_004464807.1 siphovirus Gp157 family protein -
CKV86_RS09040 1534053..1534235 - 183 WP_003691535.1 hypothetical protein -
CKV86_RS09045 1534376..1535062 - 687 WP_003693865.1 hypothetical protein -
CKV86_RS09050 1535131..1535292 - 162 WP_003691530.1 hypothetical protein -
CKV86_RS09055 1535289..1535564 - 276 WP_047923918.1 hypothetical protein -
CKV86_RS09060 1535718..1536050 - 333 WP_047923919.1 hypothetical protein -
CKV86_RS09065 1536192..1536461 - 270 WP_095176558.1 hypothetical protein -
CKV86_RS09070 1536458..1536934 - 477 WP_002255718.1 hypothetical protein -
CKV86_RS09075 1536967..1537167 - 201 WP_047917349.1 hypothetical protein -
CKV86_RS09080 1537367..1538149 + 783 WP_003689146.1 hypothetical protein -
CKV86_RS09085 1538248..1538649 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
CKV86_RS09090 1538751..1538933 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
CKV86_RS09095 1539103..1539921 - 819 WP_095176559.1 DUF3037 domain-containing protein -
CKV86_RS09100 1539918..1540616 - 699 WP_048654307.1 hypothetical protein -
CKV86_RS09105 1540855..1541553 - 699 WP_002212401.1 helix-turn-helix domain-containing protein -
CKV86_RS09110 1541593..1542246 - 654 WP_157149898.1 helix-turn-helix transcriptional regulator -
CKV86_RS09115 1542444..1542629 + 186 WP_048654326.1 helix-turn-helix domain-containing protein -
CKV86_RS13705 1542631..1542831 + 201 WP_012503750.1 hypothetical protein -
CKV86_RS09130 1543028..1543834 + 807 WP_050154472.1 replication protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1523070..1556716 33646


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T293682 WP_003689143.1 NZ_LT906437:c1538933-1538751 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT293682 WP_003691454.1 NZ_LT906437:c1538649-1538248 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References