Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 961212..961867 | Replicon | chromosome |
Accession | NZ_LT906437 | ||
Organism | Neisseria gonorrhoeae strain NCTC13799 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | CKV86_RS05580 | Protein ID | WP_003691083.1 |
Coordinates | 961212..961631 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | CKV86_RS05585 | Protein ID | WP_003688410.1 |
Coordinates | 961631..961867 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKV86_RS05560 | 956446..957987 | - | 1542 | WP_003697015.1 | multidrug efflux MFS transporter | - |
CKV86_RS05565 | 958135..958914 | + | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
CKV86_RS05570 | 958911..959612 | + | 702 | WP_003688414.1 | lactate utilization protein C | - |
CKV86_RS05575 | 959609..961063 | + | 1455 | WP_003701282.1 | iron-sulfur cluster-binding protein | - |
CKV86_RS05580 | 961212..961631 | - | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
CKV86_RS05585 | 961631..961867 | - | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
CKV86_RS05590 | 962073..962270 | - | 198 | WP_033910354.1 | IS3 family transposase | - |
CKV86_RS05595 | 962315..962893 | - | 579 | WP_003688041.1 | IS3 family transposase | - |
CKV86_RS05600 | 962898..963326 | - | 429 | WP_003701165.1 | helix-turn-helix domain-containing protein | - |
CKV86_RS05605 | 963538..963924 | + | 387 | Protein_965 | IS110 family transposase | - |
CKV86_RS05615 | 964307..965197 | - | 891 | WP_002244992.1 | succinate--CoA ligase subunit alpha | - |
CKV86_RS05620 | 965208..966374 | - | 1167 | WP_003688408.1 | ADP-forming succinate--CoA ligase subunit beta | - |
CKV86_RS05625 | 966446..966733 | - | 288 | WP_003688407.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T293681 WP_003691083.1 NZ_LT906437:c961631-961212 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|