Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 1303083..1303733 | Replicon | chromosome |
Accession | NZ_LT906435 | ||
Organism | Pandoraea sputorum strain NCTC13161 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A239SBP3 |
Locus tag | CKW10_RS05885 | Protein ID | WP_039396751.1 |
Coordinates | 1303083..1303268 (+) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A239SD75 |
Locus tag | CKW10_RS05890 | Protein ID | WP_039396753.1 |
Coordinates | 1303314..1303733 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKW10_RS05865 | 1298178..1299650 | - | 1473 | WP_052252560.1 | amino acid permease | - |
CKW10_RS05870 | 1299746..1300840 | - | 1095 | WP_039396745.1 | porin | - |
CKW10_RS05875 | 1301110..1301583 | + | 474 | WP_039396747.1 | Lrp/AsnC family transcriptional regulator | - |
CKW10_RS05880 | 1301650..1302837 | + | 1188 | WP_039396749.1 | alpha-hydroxy-acid oxidizing protein | - |
CKW10_RS05885 | 1303083..1303268 | + | 186 | WP_039396751.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
CKW10_RS05890 | 1303314..1303733 | + | 420 | WP_039396753.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
CKW10_RS05895 | 1303759..1304187 | - | 429 | WP_039396756.1 | hypothetical protein | - |
CKW10_RS05900 | 1304307..1305278 | - | 972 | WP_039396759.1 | LysR family transcriptional regulator | - |
CKW10_RS05905 | 1305593..1306906 | + | 1314 | WP_039396762.1 | MFS transporter | - |
CKW10_RS05910 | 1306985..1307779 | + | 795 | WP_039396765.1 | substrate-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 7022.03 Da Isoelectric Point: 11.5775
>T293678 WP_039396751.1 NZ_LT906435:1303083-1303268 [Pandoraea sputorum]
MKYSEFRRWLRRHGATFEQHRAGSSHFRVTLNGRSTVFPDHGAKEIGQGLVEAIKKQLGLK
MKYSEFRRWLRRHGATFEQHRAGSSHFRVTLNGRSTVFPDHGAKEIGQGLVEAIKKQLGLK
Download Length: 186 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15529.07 Da Isoelectric Point: 8.4824
>AT293678 WP_039396753.1 NZ_LT906435:1303314-1303733 [Pandoraea sputorum]
MLTYPITLKRDTNGTLLVTFPDVPEAITVGENEEDAREQALEALEAALEFYFAQKTPIPWPSRPKRGQATITLPIMASIK
VLLANEMIAQNVRKAELARRMHVNQVQVDRLLKLGYASRLDAVESAFAVLGKRLEVRAV
MLTYPITLKRDTNGTLLVTFPDVPEAITVGENEEDAREQALEALEAALEFYFAQKTPIPWPSRPKRGQATITLPIMASIK
VLLANEMIAQNVRKAELARRMHVNQVQVDRLLKLGYASRLDAVESAFAVLGKRLEVRAV
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A239SBP3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A239SD75 |