Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RelB |
| Location | 713261..713872 | Replicon | chromosome |
| Accession | NZ_LT906435 | ||
| Organism | Pandoraea sputorum strain NCTC13161 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | CKW10_RS03235 | Protein ID | WP_072633186.1 |
| Coordinates | 713261..713563 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A239S9E3 |
| Locus tag | CKW10_RS03240 | Protein ID | WP_039395723.1 |
| Coordinates | 713567..713872 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CKW10_RS03220 | 709590..710717 | + | 1128 | WP_039402208.1 | porin | - |
| CKW10_RS03225 | 710824..711873 | - | 1050 | WP_039395719.1 | aldo/keto reductase | - |
| CKW10_RS03230 | 712278..713264 | + | 987 | WP_084103423.1 | AraC family transcriptional regulator | - |
| CKW10_RS03235 | 713261..713563 | - | 303 | WP_072633186.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| CKW10_RS03240 | 713567..713872 | - | 306 | WP_039395723.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| CKW10_RS03245 | 713994..716480 | - | 2487 | WP_095178407.1 | DNA ligase D | - |
| CKW10_RS03250 | 716490..717506 | - | 1017 | WP_039395726.1 | Ku protein | - |
| CKW10_RS03255 | 717679..718209 | + | 531 | Protein_646 | hypothetical protein | - |
| CKW10_RS03260 | 718424..718675 | + | 252 | WP_039395729.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11583.26 Da Isoelectric Point: 11.5320
>T293677 WP_072633186.1 NZ_LT906435:c713563-713261 [Pandoraea sputorum]
VKLEWSQHAIQDRSDIYDFVEQRSPNAAIWIDSRINQQLLSLLRFPRAGRPGSIRGTRELVITRTPYIAAYRALPTRIRV
LRIFHNAQMWPGDAPTGPHH
VKLEWSQHAIQDRSDIYDFVEQRSPNAAIWIDSRINQQLLSLLRFPRAGRPGSIRGTRELVITRTPYIAAYRALPTRIRV
LRIFHNAQMWPGDAPTGPHH
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|