Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4651450..4652066 Replicon chromosome
Accession NZ_LT905060
Organism Salmonella enterica subsp. enterica serovar Typhi isolate ISP_03_07467_SGB110-sc-1979083

Toxin (Protein)


Gene name vapC Uniprot ID Q8Z2U3
Locus tag CJZ88_RS22925 Protein ID WP_000238494.1
Coordinates 4651450..4651824 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8E9YHE9
Locus tag CJZ88_RS22930 Protein ID WP_001523745.1
Coordinates 4651824..4652066 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CJZ88_RS22910 4648952..4649854 + 903 WP_000331359.1 formate dehydrogenase subunit beta -
CJZ88_RS22915 4649851..4650486 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
CJZ88_RS22920 4650483..4651412 + 930 WP_000027727.1 formate dehydrogenase accessory protein FdhE -
CJZ88_RS22925 4651450..4651824 - 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin Toxin
CJZ88_RS22930 4651824..4652066 - 243 WP_001523745.1 CopG family transcriptional regulator Antitoxin
CJZ88_RS22935 4652271..4653200 + 930 WP_001162859.1 alpha/beta hydrolase -
CJZ88_RS22940 4653286..4653597 + 312 WP_000558160.1 type II toxin-antitoxin system HigB family toxin -
CJZ88_RS22945 4653594..4654040 + 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin -
CJZ88_RS22950 4654055..4654996 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
CJZ88_RS22955 4655041..4655478 - 438 WP_000560975.1 D-aminoacyl-tRNA deacylase -
CJZ88_RS22960 4655475..4656347 - 873 WP_000921423.1 virulence factor BrkB family protein -
CJZ88_RS22965 4656341..4656940 - 600 WP_000965695.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13908.18 Da        Isoelectric Point: 7.3567

>T293670 WP_000238494.1 NZ_LT905060:c4651824-4651450 [Salmonella enterica subsp. enterica serovar Typhi]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.77 Da        Isoelectric Point: 4.4463

>AT293670 WP_001523745.1 NZ_LT905060:c4652066-4651824 [Salmonella enterica subsp. enterica serovar Typhi]
MMAGMDMGRILLDLSDDVIKRLDDLKVQRNLPRAELLREAVEQYLERQDRAETTISKALGLWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5I6CND8

Antitoxin

Source ID Structure

References