Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1395985..1396605 | Replicon | chromosome |
Accession | NZ_LT905060 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi isolate ISP_03_07467_SGB110-sc-1979083 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | CJZ88_RS06795 | Protein ID | WP_001280991.1 |
Coordinates | 1395985..1396203 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | CJZ88_RS06800 | Protein ID | WP_000344807.1 |
Coordinates | 1396231..1396605 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CJZ88_RS06755 | 1391208..1391777 | + | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
CJZ88_RS06760 | 1391810..1392199 | - | 390 | WP_000961285.1 | MGMT family protein | - |
CJZ88_RS06770 | 1392430..1393980 | - | 1551 | WP_000213129.1 | EAL domain-containing protein | - |
CJZ88_RS06775 | 1394205..1394465 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
CJZ88_RS06780 | 1394471..1394611 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
CJZ88_RS06785 | 1394667..1395137 | - | 471 | WP_000136183.1 | YlaC family protein | - |
CJZ88_RS06790 | 1395255..1395806 | - | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
CJZ88_RS06795 | 1395985..1396203 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
CJZ88_RS06800 | 1396231..1396605 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
CJZ88_RS06805 | 1397101..1400250 | - | 3150 | WP_001132507.1 | efflux RND transporter permease AcrB | - |
CJZ88_RS06810 | 1400273..1401466 | - | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T293661 WP_001280991.1 NZ_LT905060:c1396203-1395985 [Salmonella enterica subsp. enterica serovar Typhi]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT293661 WP_000344807.1 NZ_LT905060:c1396605-1396231 [Salmonella enterica subsp. enterica serovar Typhi]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|