Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4738677..4739227 Replicon chromosome
Accession NZ_LT903847
Organism Escherichia coli O127:H6 isolate EPEC1

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag BQ9550_RS25145 Protein ID WP_001160966.1
Coordinates 4738677..4738991 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag BQ9550_RS25150 Protein ID WP_000125566.1
Coordinates 4738994..4739227 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BQ9550_RS25120 4734352..4735638 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
BQ9550_RS25125 4735638..4736627 + 990 WP_000241226.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
BQ9550_RS25130 4736624..4737445 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
BQ9550_RS25135 4737448..4737825 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
BQ9550_RS25140 4737832..4738680 + 849 WP_000257182.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
BQ9550_RS25145 4738677..4738991 - 315 WP_001160966.1 CcdB family protein Toxin
BQ9550_RS25150 4738994..4739227 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
BQ9550_RS25155 4739313..4739792 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
BQ9550_RS25160 4739984..4741846 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
BQ9550_RS25165 4741839..4742369 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
BQ9550_RS25170 4742477..4743808 - 1332 WP_001183210.1 MFS transporter -
BQ9550_RS25175 4743867..4744154 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T293656 WP_001160966.1 NZ_LT903847:c4738991-4738677 [Escherichia coli O127:H6]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT293656 WP_000125566.1 NZ_LT903847:c4739227-4738994 [Escherichia coli O127:H6]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References