Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3636065..3636860 | Replicon | chromosome |
| Accession | NZ_LT903847 | ||
| Organism | Escherichia coli O127:H6 isolate EPEC1 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | B7UP43 |
| Locus tag | BQ9550_RS19310 | Protein ID | WP_000854914.1 |
| Coordinates | 3636065..3636439 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7UP42 |
| Locus tag | BQ9550_RS19315 | Protein ID | WP_001280955.1 |
| Coordinates | 3636486..3636860 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BQ9550_RS19270 | 3631070..3631561 | - | 492 | WP_001340063.1 | DUF1097 domain-containing protein | - |
| BQ9550_RS19275 | 3631663..3632217 | - | 555 | WP_001001921.1 | molecular chaperone YcdY | - |
| BQ9550_RS19280 | 3632241..3632978 | - | 738 | WP_000283657.1 | zinc-binding phosphatase | - |
| BQ9550_RS19285 | 3633033..3633971 | - | 939 | WP_000351277.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| BQ9550_RS19295 | 3634441..3635283 | - | 843 | WP_001280481.1 | DUF4942 domain-containing protein | - |
| BQ9550_RS19300 | 3635368..3635565 | - | 198 | WP_000839282.1 | DUF957 domain-containing protein | - |
| BQ9550_RS19305 | 3635577..3636068 | - | 492 | WP_000976857.1 | hypothetical protein | - |
| BQ9550_RS19310 | 3636065..3636439 | - | 375 | WP_000854914.1 | TA system toxin CbtA family protein | Toxin |
| BQ9550_RS19315 | 3636486..3636860 | - | 375 | WP_001280955.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| BQ9550_RS19320 | 3637023..3637244 | - | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| BQ9550_RS19325 | 3637307..3637783 | - | 477 | WP_001186738.1 | RadC family protein | - |
| BQ9550_RS19330 | 3637799..3638284 | - | 486 | WP_000214398.1 | antirestriction protein | - |
| BQ9550_RS19335 | 3638375..3639193 | - | 819 | WP_001234664.1 | DUF945 domain-containing protein | - |
| BQ9550_RS19350 | 3639533..3640603 | - | 1071 | WP_000102671.1 | patatin-like phospholipase family protein | - |
| BQ9550_RS19355 | 3640600..3641505 | - | 906 | WP_000203541.1 | chemotaxis protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14117.17 Da Isoelectric Point: 7.7761
>T293653 WP_000854914.1 NZ_LT903847:c3636439-3636065 [Escherichia coli O127:H6]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13767.59 Da Isoelectric Point: 6.6248
>AT293653 WP_001280955.1 NZ_LT903847:c3636860-3636486 [Escherichia coli O127:H6]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LXR5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9P0D0 |