Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1620669..1621323 | Replicon | chromosome |
Accession | NZ_LT903847 | ||
Organism | Escherichia coli O127:H6 isolate EPEC1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | BQ9550_RS08390 | Protein ID | WP_000244781.1 |
Coordinates | 1620916..1621323 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | BQ9550_RS08385 | Protein ID | WP_000354046.1 |
Coordinates | 1620669..1620935 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BQ9550_RS08365 | 1616757..1618190 | - | 1434 | WP_001339296.1 | 6-phospho-beta-glucosidase BglA | - |
BQ9550_RS08370 | 1618235..1618546 | + | 312 | WP_001182959.1 | N(4)-acetylcytidine aminohydrolase | - |
BQ9550_RS08375 | 1618710..1619369 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
BQ9550_RS08380 | 1619446..1620426 | - | 981 | WP_000886076.1 | tRNA-modifying protein YgfZ | - |
BQ9550_RS08385 | 1620669..1620935 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
BQ9550_RS08390 | 1620916..1621323 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
BQ9550_RS08395 | 1621363..1621884 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
BQ9550_RS08400 | 1621996..1622892 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
BQ9550_RS08405 | 1622917..1623627 | + | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
BQ9550_RS08410 | 1623633..1625366 | + | 1734 | WP_000813189.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T293642 WP_000244781.1 NZ_LT903847:1620916-1621323 [Escherichia coli O127:H6]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|