Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 1090786..1091417 | Replicon | chromosome |
Accession | NZ_LT903847 | ||
Organism | Escherichia coli O127:H6 isolate EPEC1 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | L4J012 |
Locus tag | BQ9550_RS05490 | Protein ID | WP_001260301.1 |
Coordinates | 1090786..1091061 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | U9Y7E1 |
Locus tag | BQ9550_RS05495 | Protein ID | WP_000593555.1 |
Coordinates | 1091058..1091417 (+) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BQ9550_RS05475 | 1085790..1086857 | + | 1068 | WP_000361455.1 | HlyD family secretion protein | - |
BQ9550_RS05480 | 1086854..1089589 | + | 2736 | WP_000149096.1 | ribosome-associated ATPase/putative transporter RbbA | - |
BQ9550_RS05485 | 1089589..1090713 | + | 1125 | WP_001314210.1 | ABC transporter permease | - |
BQ9550_RS05490 | 1090786..1091061 | + | 276 | WP_001260301.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
BQ9550_RS05495 | 1091058..1091417 | + | 360 | WP_000593555.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
BQ9550_RS05500 | 1091537..1091938 | - | 402 | WP_001190063.1 | nickel-responsive transcriptional regulator NikR | - |
BQ9550_RS05505 | 1091944..1092750 | - | 807 | WP_000173679.1 | nickel import ATP-binding protein NikE | - |
BQ9550_RS05510 | 1092747..1093511 | - | 765 | WP_001136232.1 | nickel import ATP-binding protein NikD | - |
BQ9550_RS05515 | 1093511..1094344 | - | 834 | WP_001008954.1 | nickel ABC transporter permease subunit NikC | - |
BQ9550_RS05520 | 1094341..1095285 | - | 945 | WP_000947070.1 | nickel ABC transporter permease subunit NikB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10185.87 Da Isoelectric Point: 10.6128
>T293641 WP_001260301.1 NZ_LT903847:1090786-1091061 [Escherichia coli O127:H6]
MRTQVQALRKKQKNTLDQIFKSPVPQGIKWSDIESLVKALGGEIKEGRGSRCKFILNMSVACFHRPHPSPDTDKGAVESV
RDWLLSIGVKP
MRTQVQALRKKQKNTLDQIFKSPVPQGIKWSDIESLVKALGGEIKEGRGSRCKFILNMSVACFHRPHPSPDTDKGAVESV
RDWLLSIGVKP
Download Length: 276 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13402.27 Da Isoelectric Point: 5.1987
>AT293641 WP_000593555.1 NZ_LT903847:1091058-1091417 [Escherichia coli O127:H6]
MIKLKTPNSMEIAGQPAVITYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGELSLREYLEDCKAAGIEPYARTEKIKT
FTLRYPESLSERLNNAAAQQQVSVNTYIIETLNERLNHL
MIKLKTPNSMEIAGQPAVITYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGELSLREYLEDCKAAGIEPYARTEKIKT
FTLRYPESLSERLNNAAAQQQVSVNTYIIETLNERLNHL
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | L4J012 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LKZ6 |