Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higB-toxA/Tad-PHA01976 |
Location | 2211262..2211919 | Replicon | chromosome |
Accession | NZ_LT900217 | ||
Organism | Gordonibacter urolithinfaciens strain DSM 27213T |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | BN3560_RS14380 | Protein ID | WP_157780568.1 |
Coordinates | 2211262..2211627 (+) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | BN3560_RS09515 | Protein ID | WP_096227865.1 |
Coordinates | 2211620..2211919 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN3560_RS09490 | 2206834..2207811 | + | 978 | WP_096227861.1 | phosphate ABC transporter permease PstA | - |
BN3560_RS09495 | 2207804..2208670 | + | 867 | WP_096227862.1 | phosphate ABC transporter ATP-binding protein | - |
BN3560_RS09500 | 2208790..2209479 | + | 690 | WP_015539548.1 | response regulator transcription factor | - |
BN3560_RS09505 | 2209532..2210950 | + | 1419 | WP_096227863.1 | two-component sensor histidine kinase | - |
BN3560_RS14380 | 2211262..2211627 | + | 366 | WP_157780568.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
BN3560_RS09515 | 2211620..2211919 | + | 300 | WP_096227865.1 | helix-turn-helix transcriptional regulator | Antitoxin |
BN3560_RS09520 | 2212498..2213847 | + | 1350 | WP_096228652.1 | replication-associated recombination protein A | - |
BN3560_RS09525 | 2213957..2214646 | + | 690 | Protein_1878 | DUF948 domain-containing protein | - |
BN3560_RS09530 | 2214737..2216032 | + | 1296 | WP_172623286.1 | AI-2E family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 14508.77 Da Isoelectric Point: 10.5359
>T293634 WP_157780568.1 NZ_LT900217:2211262-2211627 [Gordonibacter urolithinfaciens]
MYKVELYHDAKGRSELLDTLRKLEDKSSTDKEARTAYLSMLKAISELEGHGTRIGMPTVRHVRGEIWELRPKSQRVFFFF
WKDNTFVLLHSYIKKTQKTPRREIMKAERKKRDWIARHADE
MYKVELYHDAKGRSELLDTLRKLEDKSSTDKEARTAYLSMLKAISELEGHGTRIGMPTVRHVRGEIWELRPKSQRVFFFF
WKDNTFVLLHSYIKKTQKTPRREIMKAERKKRDWIARHADE
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|