Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-AbrB |
Location | 1690485..1691170 | Replicon | chromosome |
Accession | NZ_LT900021 | ||
Organism | Thermococcus henrietii strain EXT12c |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | CS910_RS09235 | Protein ID | WP_099211419.1 |
Coordinates | 1690766..1691170 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | CS910_RS09230 | Protein ID | WP_223211952.1 |
Coordinates | 1690485..1690769 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CS910_RS09205 | 1686415..1688193 | + | 1779 | WP_099211407.1 | carbon starvation protein A | - |
CS910_RS09210 | 1688233..1688499 | + | 267 | WP_099211409.1 | hypothetical protein | - |
CS910_RS09215 | 1688509..1689510 | + | 1002 | WP_099211411.1 | ArsA family ATPase | - |
CS910_RS09220 | 1689491..1689781 | + | 291 | WP_099211413.1 | iron-sulfur cluster assembly protein | - |
CS910_RS09225 | 1689781..1690437 | + | 657 | WP_099211415.1 | hypothetical protein | - |
CS910_RS09230 | 1690485..1690769 | + | 285 | WP_223211952.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
CS910_RS09235 | 1690766..1691170 | + | 405 | WP_099211419.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
CS910_RS09240 | 1691172..1691954 | + | 783 | WP_099211421.1 | alpha/beta hydrolase | - |
CS910_RS09245 | 1692023..1694077 | + | 2055 | WP_099211423.1 | hypothetical protein | - |
CS910_RS09250 | 1694070..1695089 | - | 1020 | WP_099211425.1 | adenylosuccinate synthetase | - |
CS910_RS09255 | 1695248..1695541 | + | 294 | WP_158523833.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15590.06 Da Isoelectric Point: 4.4500
>T293631 WP_099211419.1 NZ_LT900021:1690766-1691170 [Thermococcus henrietii]
MKLFIDTNLFVYLLTKTPEDERKIIEFYAKLIENHDLYTSPLVLDETIHVAKKKYSVPYELSIEFIDEKVLPYVEVLPLT
VFDYLTARQIIMNYNLRPSDALHVAVIENNGLQAIVSEDEDFDVLPLKRVWLGG
MKLFIDTNLFVYLLTKTPEDERKIIEFYAKLIENHDLYTSPLVLDETIHVAKKKYSVPYELSIEFIDEKVLPYVEVLPLT
VFDYLTARQIIMNYNLRPSDALHVAVIENNGLQAIVSEDEDFDVLPLKRVWLGG
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|