Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-AbrB |
Location | 90638..91245 | Replicon | chromosome |
Accession | NZ_LT900021 | ||
Organism | Thermococcus henrietii strain EXT12c |
Toxin (Protein)
Gene name | vapC | Uniprot ID | W8NUN6 |
Locus tag | CS910_RS00515 | Protein ID | WP_042690980.1 |
Coordinates | 90859..91245 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | CS910_RS00510 | Protein ID | WP_099209227.1 |
Coordinates | 90638..90862 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CS910_RS00500 | 86067..87476 | - | 1410 | WP_099209225.1 | ATP-binding protein | - |
CS910_RS00505 | 87537..90548 | - | 3012 | WP_099209226.1 | N-6 DNA methylase | - |
CS910_RS00510 | 90638..90862 | + | 225 | WP_099209227.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
CS910_RS00515 | 90859..91245 | + | 387 | WP_042690980.1 | PIN domain-containing protein | Toxin |
CS910_RS00520 | 91242..92657 | - | 1416 | WP_099209228.1 | ribonuclease E/G | - |
CS910_RS00525 | 92629..93360 | - | 732 | WP_099209229.1 | hypothetical protein | - |
CS910_RS00530 | 93487..94413 | + | 927 | WP_099209230.1 | GTP 3',8-cyclase MoaA | - |
CS910_RS00535 | 94457..95404 | + | 948 | WP_099209231.1 | DUF835 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14672.16 Da Isoelectric Point: 9.8982
>T293630 WP_042690980.1 NZ_LT900021:90859-91245 [Thermococcus henrietii]
MTVIDTNVFLYAVLKDSELNEEARNLLASLERWVVPSMVLYELYWFLKKREYSVEDINGVISAVLSSPRTKVVGDNGKYT
KEALKLTKNPKRFNDMVILATAKDFGRLATYDKKLRKEAEKLGIKVLP
MTVIDTNVFLYAVLKDSELNEEARNLLASLERWVVPSMVLYELYWFLKKREYSVEDINGVISAVLSSPRTKVVGDNGKYT
KEALKLTKNPKRFNDMVILATAKDFGRLATYDKKLRKEAEKLGIKVLP
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|