Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-Phd |
| Location | 528085..528663 | Replicon | chromosome |
| Accession | NZ_LT897798 | ||
| Organism | Vibrio cholerae isolate Vibrio cholerae str. BC1071 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | VCBK1071_RS17240 | Protein ID | WP_059261326.1 |
| Coordinates | 528085..528402 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | VCBK1071_RS17245 | Protein ID | WP_000288450.1 |
| Coordinates | 528421..528663 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VCBK1071_RS17200 | 523743..524114 | + | 372 | WP_172440206.1 | DUF4144 domain-containing protein | - |
| VCBK1071_RS17205 | 524143..525102 | - | 960 | WP_101411759.1 | IS30 family transposase | - |
| VCBK1071_RS17215 | 525336..525737 | + | 402 | WP_052469078.1 | hypothetical protein | - |
| VCBK1071_RS17220 | 525870..526019 | - | 150 | Protein_586 | RES family NAD+ phosphorylase | - |
| VCBK1071_RS17225 | 526140..527180 | + | 1041 | WP_101411691.1 | IS481 family transposase | - |
| VCBK1071_RS17230 | 527332..527610 | - | 279 | WP_000578471.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
| VCBK1071_RS17235 | 527607..527891 | - | 285 | WP_033932134.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| VCBK1071_RS17240 | 528085..528402 | - | 318 | WP_059261326.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| VCBK1071_RS17245 | 528421..528663 | - | 243 | WP_000288450.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| VCBK1071_RS17250 | 528915..529271 | + | 357 | WP_158087279.1 | hypothetical protein | - |
| VCBK1071_RS17255 | 529415..530044 | + | 630 | WP_001009011.1 | type B chloramphenicol O-acetyltransferase | - |
| VCBK1071_RS17260 | 530341..530509 | + | 169 | Protein_594 | DUF645 family protein | - |
| VCBK1071_RS17265 | 530716..531027 | + | 312 | WP_000623749.1 | hypothetical protein | - |
| VCBK1071_RS17270 | 531206..531709 | + | 504 | WP_101411846.1 | DinB family protein | - |
| VCBK1071_RS17275 | 531827..532144 | - | 318 | WP_101411848.1 | CcdB family protein | - |
| VCBK1071_RS17280 | 532144..532389 | - | 246 | WP_001260797.1 | type II toxin-antitoxin system CcdA family antitoxin | - |
| VCBK1071_RS17285 | 532569..533081 | + | 513 | Protein_599 | MazG-related protein | - |
| VCBK1071_RS17290 | 533222..533656 | + | 435 | WP_084980789.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | catB9 | - | 383416..535863 | 152447 | |
| - | inside | IS/Tn | catB9 | - | 526140..530044 | 3904 | |
| - | inside | Integron | catB9 | - | 386674..535863 | 149189 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12194.02 Da Isoelectric Point: 9.5547
>T293629 WP_059261326.1 NZ_LT897798:c528402-528085 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIRNYTIENFAQAQWLKYKSTLLSGFQTLADNPELGKSCEDIYKNGFYFPVGKHMAYYTKEAD
FILIVAVLGQSQLPQKHLTQSRFVS
MQNKQYKLSQLAQEHLLKIRNYTIENFAQAQWLKYKSTLLSGFQTLADNPELGKSCEDIYKNGFYFPVGKHMAYYTKEAD
FILIVAVLGQSQLPQKHLTQSRFVS
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|