293628

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 527332..527891 Replicon chromosome
Accession NZ_LT897798
Organism Vibrio cholerae isolate Vibrio cholerae str. BC1071

Toxin (Protein)


Gene name relE Uniprot ID D7HHK2
Locus tag VCBK1071_RS17230 Protein ID WP_000578471.1
Coordinates 527332..527610 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag VCBK1071_RS17235 Protein ID WP_033932134.1
Coordinates 527607..527891 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
VCBK1071_RS17195 522648..523652 + 1005 WP_101411842.1 LD-carboxypeptidase -
VCBK1071_RS17200 523743..524114 + 372 WP_172440206.1 DUF4144 domain-containing protein -
VCBK1071_RS17205 524143..525102 - 960 WP_101411759.1 IS30 family transposase -
VCBK1071_RS17215 525336..525737 + 402 WP_052469078.1 hypothetical protein -
VCBK1071_RS17220 525870..526019 - 150 Protein_586 RES family NAD+ phosphorylase -
VCBK1071_RS17225 526140..527180 + 1041 WP_101411691.1 IS481 family transposase -
VCBK1071_RS17230 527332..527610 - 279 WP_000578471.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
VCBK1071_RS17235 527607..527891 - 285 WP_033932134.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
VCBK1071_RS17240 528085..528402 - 318 WP_059261326.1 type II toxin-antitoxin system RelE/ParE family toxin -
VCBK1071_RS17245 528421..528663 - 243 WP_000288450.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
VCBK1071_RS17250 528915..529271 + 357 WP_158087279.1 hypothetical protein -
VCBK1071_RS17255 529415..530044 + 630 WP_001009011.1 type B chloramphenicol O-acetyltransferase -
VCBK1071_RS17260 530341..530509 + 169 Protein_594 DUF645 family protein -
VCBK1071_RS17265 530716..531027 + 312 WP_000623749.1 hypothetical protein -
VCBK1071_RS17270 531206..531709 + 504 WP_101411846.1 DinB family protein -
VCBK1071_RS17275 531827..532144 - 318 WP_101411848.1 CcdB family protein -
VCBK1071_RS17280 532144..532389 - 246 WP_001260797.1 type II toxin-antitoxin system CcdA family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 383416..535863 152447
- inside IS/Tn catB9 - 526140..530044 3904
- inside Integron catB9 - 386674..535863 149189


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-70)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10838.56 Da        Isoelectric Point: 4.6794

>T293628 WP_000578471.1 NZ_LT897798:c527610-527332 [Vibrio cholerae]
MIFWEEASLNDREKIFEFLYDFNPAAAEKTDELIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10915.28 Da        Isoelectric Point: 8.0775

>AT293628 WP_033932134.1 NZ_LT897798:c527891-527607 [Vibrio cholerae]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFESGKAVFIEHDIAKAR
MAERKAKIRNRGHA

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A271VKS2

Antitoxin

Source ID Structure

References